KEGG   Alicyclobacillus acidocaldarius subsp. acidocaldarius Tc-4-1: TC41_2246Help
Entry
TC41_2246         CDS       T01821                                 

Gene name
mutS2
Definition
(GenBank) MutS2 family protein
  KO
K07456  DNA mismatch repair protein MutS2
Organism
aad  Alicyclobacillus acidocaldarius subsp. acidocaldarius Tc-4-1
Pathway
aad03430  Mismatch repair
Brite
KEGG Orthology (KO) [BR:aad00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03430 Mismatch repair
    TC41_2246 (mutS2)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03400 DNA repair and recombination proteins [BR:aad03400]
    TC41_2246 (mutS2)
DNA repair and recombination proteins [BR:aad03400]
 Prokaryotic Type
  SSBR (single strand breaks repair)
   MMR (mismatch exicision repair)
    Mismatch and loop recognition factors
     TC41_2246 (mutS2)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: MutS_V Smr ERM HMMR_N SPATA24 AAA_22
Motif
Other DBs
NCBI-ProteinID: AEJ44150
UniProt: F8IFR6
Position
complement(2141500..2143839)
Genome map
AA seq 779 aa AA seqDB search
MRDMDERALDALEYEAVRDEIAKCAQTSLGQARARAMEPFPVRADAEAELARLDEAVRML
YRVGAPPFAGIESLAEVVKRAQRGGTLSADEANRLARCIAGMRAMRQFVERAAEGGDFPL
LASTVAPMADLRRTEQEIRQVVDEDGQVVDHASPTLLRLRDEKRRREAEIRAALDRLLRT
QAKYLQEPVIAMRGEHYCLPVRVEHKSQIPGIVRDVSSSGSTVFIEPRTIVELSERVREL
EVLEEREVERLLYQLAAAVAQVADDFLRTLDVAAEVDFVFAKAAYARRVDGKRPRLTEGV
WRLYGARHPKLHRDAVPIDVELGDRFRLLIITGPNTGGKTVTLKTIGLLTLMGMSGLFLP
TKRESDIGFCRHVFVDIGDEQSIEQNLSTFSSHMRRIIDMLERVTPDSLVLLDELGAGTD
PAEGSALAIAILDHLTSVGARVVATTHYAELKGYAFRNPAAENASMEFDVETLRPTYRLL
MGVPGRSNALAIAERLGMPKEILERARSHVAESNIHVEDLIGKLEAASREAERMRDEAER
ALREARDQAADLARQKAAWEASKDSMREQAAREAREVIERARREADAVIREIRSLRDRAA
VKDHELVELRKRLEAAEPGEKRTPARRRMRAEVRPGQRVRVLSLGQKGDVVEVAQDGRAA
VVQLGAMRMKVDASDLEVVGDAQPAAAPSVTRLGGAKDVRMELDVRGESVDDAISRIDKY
LDDAVVAGISRVVIIHGKGTGALRTAIRRYLRDHPHVKSSEPAGPGEGGDGATVVHVRT
NT seq 2340 nt NT seq  +upstreamnt  +downstreamnt
gtgcgggacatggacgaacgcgcgctggacgcgttggagtacgaagctgtgcgcgacgaa
atcgccaagtgtgcgcagacctcgcttgggcaggctcgggcgcgcgccatggagcccttt
cccgtgcgcgccgacgcggaagcggagctcgcccgtctggacgaggcggtgcgcatgctg
tatcgcgtcggggcgcccccgtttgcggggattgaatcgctggccgaagtggtcaagcgc
gctcaacgtggagggaccctgtcggctgacgaagcgaatcgactcgcccgatgcattgct
ggaatgcgggcgatgcggcagttcgtggagcgagcggccgaaggtggcgattttcccctt
ttggcgagcaccgtcgcgccaatggcggatctgcgcagaaccgaacaggaaatccggcaa
gtggtggacgaggatggtcaggtggtggatcacgcgagcccgacgcttctccgcttgcgc
gacgagaagcggcgccgcgaggcggagatccgcgccgcgctcgatcggttgctccgcaca
caggccaaatatctgcaggagccggtcattgcgatgcgaggtgaacattattgtctgccg
gtgcgcgtcgagcacaagagccagatccccgggatcgtgcgcgacgtgtcctcgtcggga
tcgaccgtgttcatcgagccccgcaccattgtggaattgagtgagcgggtgcgcgagctc
gaggtgctcgaggagcgcgaggtcgagcggctcctgtaccagttggcggcggctgtggcg
caggtggcggacgacttcttgcgcacgctcgacgtagccgctgaagtggactttgtcttc
gcgaaggcggcctatgcgcggcgtgtggacggaaagcggccgcggctgacggaaggcgta
tggcggctttacggcgctcggcatcccaagcttcatcgagatgccgtgcccatcgacgtc
gagctcggggatcggttccgactgctcatcatcacggggccgaacacgggcgggaagacg
gtcacgttgaagaccatcggtcttctcacgctgatgggcatgtcggggctgtttttgccg
accaagcgggagagcgacattggcttctgccggcacgtgttcgtcgacatcggggacgag
cagagcattgagcagaatctgtccacgttttcgtcccacatgcggcggattatcgacatg
ctcgagcgcgtgacgccagacagcctcgtgctgttggacgagctcggggcgggaaccgat
ccggccgaaggttctgcactcgccatcgccatcttggatcacctcacgtcggtcggcgcc
cgcgtcgtggccacgacgcactacgccgaactcaagggctacgccttccgcaatccggcg
gccgaaaacgcgagcatggaatttgacgtggagacgctgcggccgacgtaccggctgctg
atgggggtgccgggccgttcgaacgcgcttgccattgcggaacggctggggatgccgaag
gagatcctcgagcgggcgagatcgcacgtggcagaatcgaacatccacgtggaagacctc
atcggcaagctcgaggccgcaagccgagaagcggagcggatgagggacgaagccgagcgg
gcgctccgggaggctcgcgaccaagcggccgatctcgcgcgtcagaaggcggcgtgggag
gcttcgaaggactcgatgcgggaacaggccgcgcgcgaagcgcgcgaggtcatcgagcgg
gcccggcgggaggcggatgccgtcatccgggagattcggagcctgcgcgatagagccgcc
gtcaaggaccacgagctggtcgagttgaggaagcgattggaggccgcggagccgggggag
aagcgcacaccagcgcggcggcgaatgcgggccgaggtgcgccctggtcagcgggtgcgc
gtgttgtcgttggggcaaaagggcgacgtggtcgaggtggcgcaggacggccgagcggcg
gtggtgcaattgggcgccatgcggatgaaagtcgatgccagcgacctggaagtggtgggc
gatgcgcagccagcggcggccccttcggtgacgcggcttggtggcgccaaagacgtgcgg
atggaactcgacgtgcgcggcgagagcgtggacgacgccatcagccggatcgacaagtat
ctggacgacgccgtggtcgccggcatctcgcgcgtcgtcatcatccacggcaagggcacg
ggtgcgctacgcaccgccatccgccggtacctgcgcgatcatccgcacgtgaaatcgagc
gagcccgccgggccaggcgagggtggcgatggcgcgaccgtcgtccacgtgcgaacgtga

DBGET integrated database retrieval system