KEGG   Alicyclobacillus acidocaldarius subsp. acidocaldarius Tc-4-1: TC41_2250Help
Entry
TC41_2250         CDS       T01821                                 

Gene name
pheT
Definition
(GenBank) phenylalanyl-tRNA synthetase, beta subunit
  KO
K01890  phenylalanyl-tRNA synthetase beta chain [EC:6.1.1.20]
Organism
aad  Alicyclobacillus acidocaldarius subsp. acidocaldarius Tc-4-1
Pathway
aad00970  Aminoacyl-tRNA biosynthesis
Module
aad_M00360  Aminoacyl-tRNA biosynthesis, prokaryotes
Brite
KEGG Orthology (KO) [BR:aad00001]
 09120 Genetic Information Processing
  09122 Translation
   00970 Aminoacyl-tRNA biosynthesis
    TC41_2250 (pheT)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:aad01007]
    TC41_2250 (pheT)
  09182 Protein families: genetic information processing
   03016 Transfer RNA biogenesis [BR:aad03016]
    TC41_2250 (pheT)
Enzymes [BR:aad01000]
 6. Ligases
  6.1  Forming carbon-oxygen bonds
   6.1.1  Ligases forming aminoacyl-tRNA and related compounds
    6.1.1.20  phenylalanine---tRNA ligase
     TC41_2250 (pheT)
Amino acid related enzymes [BR:aad01007]
 Aminoacyl-tRNA synthetase
  Class II (U)
   TC41_2250 (pheT)
Transfer RNA biogenesis [BR:aad03016]
 Eukaryotic Type
  Aminoacyl-tRNA synthetases (AARSs)
   Other AARSs
    TC41_2250 (pheT)
 Prokaryotic Type
    TC41_2250 (pheT)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: B3_4 FDX-ACB tRNA_bind B5
Motif
Other DBs
NCBI-ProteinID: AEJ44154
UniProt: F8IFS0
Position
complement(2145266..2147677)
Genome map
AA seq 803 aa AA seqDB search
MRASYKWLAEYLDLAGLSPADLADRLTSAGLAVDAVDPLNHGVEGVVIGKILDVRPHPQA
DRLKVCQVDVGGPQLEIVCGAPNAAPGLVVPVALPGAKLPGGVEIRIAEFRGVRSHGMLC
SADELGIETRYLPKRDAEGLFVLPADLPLGADVIPHLHLDDVVLDLDLTPNRSDCLSIRG
LVHELSAILRRPHRFPASVAAPEADGESPLQVRLETPRCPRYEAQLLDGADIRETPLWMK
MRLLAMGVRSIDLVVDVTNYVMLEWGQPLHAFDADAIAHGTIVVRQARDGERLVTLDGQE
RVLTSDMIVIADPEKAIGLAGVMGGENSEIGPSTRRIALESACFDGASIRRTGQALSLRS
EAQQRFEKGVDPAAVSSALHRATELLVELAGSHPVGAPRRVKAQTDVLKPTIISFSPHLC
AQFLGVDVPEQEMRACFEALGFGVAEGENEWRVEVPSRRPDVQMPADLYEEVARLYGYDH
IPATSMRLPVEAPESSGHLMLVRKVRRALVDWGLCEVRTYALTSPEAEAPVSPSGAPVSL
LRPMSDDRRTLRRHLLPSLAEVARHNLAHQVPGGAIFEVGKVFLAASWPQEVLPEERAVL
GMLWFGETEGDPFERPRRYDFYDAKGACDALLARLGIQAAYRVSQHGYLHPGRQASIEVN
GEPVGLVGELHPDVGEAYEVERAVYAEFDLGRLFSLASSDVRVLPIPRHPASRRDLAVVV
PRELESQALIDAAWRALRERGDLRLVRVFDVYTGAGVPEGYKSLAIALWFQRDERTLTDA
EIDEAVEAVLRAWEDAFGAKLRA
NT seq 2412 nt NT seq  +upstreamnt  +downstreamnt
gtgagagcatcgtacaagtggctggccgaatatctcgatctcgcgggcctatcgccagct
gacctcgcggatcgcctgacgagcgcgggcctggctgtggacgcggtcgatcccttgaat
cacggcgtggagggcgtcgtgatcggcaagatcctcgatgtgcggccgcatccccaggcg
gatcggctcaaggtctgtcaggtggacgtgggcggtccacaactcgaaattgtctgcggg
gcgcccaatgccgcgccggggctcgtggtgccggtggcactgcccggggcgaagctgccg
ggcggcgtggagatccggattgccgagtttcgcggcgttaggtcgcacggcatgctgtgt
tcggcggacgagctcggcatcgagacgcggtacctgccgaagcgagatgcagaggggctc
ttcgtcctgcccgcggacctgccgctcggcgcagacgttatcccgcatcttcacctggac
gacgtggtgctggatctcgacctcacgcccaaccggagcgattgcctgtccatccggggc
ctggtgcacgagctttccgccatcctgcggcggccgcatcggttccccgcatcggttgcg
gcgccggaggctgacggcgaatctccgctccaagtgcgccttgagacgccccggtgcccc
cgctacgaggctcaacttctcgacggcgccgatatccgggagacgccgctttggatgaag
atgcggctgttggccatgggcgtccgctccatcgatctcgtcgtcgatgtgacgaactac
gtaatgctggaatggggccagcctctgcacgcctttgatgctgacgccattgcgcacggg
accatcgtcgttcggcaggcccgggacggcgaacggctcgtgacgctcgacggccaggag
cgggtgttgacgtcggatatgatcgtgattgccgatccggagaaggccattgggctcgcg
ggcgtgatgggcggcgaaaatagtgaaatcggcccctcgacgcggcgaattgcgctcgaa
tccgcctgttttgacggcgcctccatccggagaacgggccaggccctctcgcttcgctcg
gaggcgcagcagcgctttgaaaagggtgtcgatccggcagccgtctcgagcgcattgcac
cgggcgaccgagcttctcgttgaactggcgggatcgcaccccgtcggcgcgccgcgccgc
gtcaaggcgcaaaccgacgtgctgaagccgaccatcatctccttctccccgcatctgtgc
gctcagttcctcggcgtggatgtgcccgagcaagagatgcgcgcgtgcttcgaggccctc
ggctttggcgttgcggaaggagaaaacgagtggcgcgtggaggtgccgtcgcggcgcccg
gacgtgcagatgccggccgatttgtacgaggaagtggctcggctctacgggtacgaccat
atccccgccacgtccatgcgactgccggtggaagcgccagagtcgtccggccacctcatg
ctcgtgcgcaaggtgaggcgtgcgctcgtcgactgggggctttgcgaggtgcggacgtac
gcgctcacatcgcccgaggccgaagcaccagtctcgccgagcggcgccccggtatccctc
ctgcggcccatgtccgacgatcgccgcaccttgcgccgtcacctgttgccaagcctcgcg
gaggtggcgcggcacaatctggcgcatcaagttccgggtggcgccatctttgaggtcggg
aaggtgttcctggcggcctcctggccccaggaggtgttgccggaagagcgcgctgtcctc
ggcatgctgtggttcggcgagacggaaggcgatcccttcgagcgcccgcgccgctacgac
ttctacgacgccaagggcgcctgcgacgcacttctggcgcgccttgggattcaggccgcg
tatcgggtcagtcagcatgggtatctccatccaggccgtcaggcgtccatcgaagtgaac
ggcgagcccgtcgggctcgtcggggaactgcatcccgacgtcggcgaagcctacgaagtc
gagcgcgctgtgtacgcggagtttgatcttggccgcctgttctcgctcgcctcttcggac
gtgcgtgtgctgcccatcccgcgccatcctgcaagccgccgagacctcgccgtcgtggtg
ccgcgggaactcgagtcgcaggcactgatcgatgcggcgtggcgggcgcttcgcgagcgc
ggcgatctgcggctggtccgcgtgttcgacgtgtacacgggtgcgggcgtgccggaaggg
tacaaaagcctggccatcgcgctctggttccagcgcgatgagcgcacattgacggacgcc
gagatcgacgaagcggtggaggcggtgctccgagcttgggaggacgctttcggcgcgaag
cttcgcgcctaa

DBGET integrated database retrieval system