KEGG   Alicyclobacillus acidocaldarius subsp. acidocaldarius Tc-4-1: TC41_2254Help
Entry
TC41_2254         CDS       T01821                                 

Gene name
purE
Definition
(GenBank) phosphoribosylaminoimidazole carboxylase, catalytic subunit
  KO
K01588  5-(carboxyamino)imidazole ribonucleotide mutase [EC:5.4.99.18]
Organism
aad  Alicyclobacillus acidocaldarius subsp. acidocaldarius Tc-4-1
Pathway
aad00230  Purine metabolism
aad01100  Metabolic pathways
aad01110  Biosynthesis of secondary metabolites
aad01130  Biosynthesis of antibiotics
Module
aad_M00048  Inosine monophosphate biosynthesis, PRPP + glutamine => IMP
Brite
KEGG Orthology (KO) [BR:aad00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00230 Purine metabolism
    TC41_2254 (purE)
Enzymes [BR:aad01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.99  Transferring other groups
    5.4.99.18  5-(carboxyamino)imidazole ribonucleotide mutase
     TC41_2254 (purE)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AIRC
Motif
Other DBs
NCBI-ProteinID: AEJ44158
UniProt: F8IFS4
Position
complement(2150283..2150792)
Genome map
AA seq 169 aa AA seqDB search
MTQPRVGVIMGSQSDWETMRHACAVLDELGIPHERKVVSAHRTPDFMFEYAASARERGIQ
VIIAGAGGAAHLPGMVASKTTLPVIGVPVQTSALGGLDSLLSIVQMPGGVPVATMAIGRA
GAINAGLMAARILAVTDAEIAARLEARRQSIRDQVLQGGDPGAEATETR
NT seq 510 nt NT seq  +upstreamnt  +downstreamnt
atgacacagccgcgcgtaggcgtgatcatgggcagccagagcgactgggagacgatgcgc
cacgcgtgcgccgtgttggacgagctcgggattccgcacgagcgcaaggtggtctcggcg
cacaggacgccggatttcatgttcgagtatgcggcttccgcgcgagagcgcggcattcag
gtcatcatcgccggagcgggcggcgccgctcacttgcccggcatggtggcgtccaagacg
acgttgcccgtcatcggcgtgcctgtgcagacgtcggcgctcggcggcctcgactctctc
ctgtccatcgtgcagatgcccggtggcgtgccggtggccaccatggccatcggccgcgca
ggggccatcaacgcggggctcatggcggcgcgcattctcgcggtgacggatgccgagatc
gccgctcgattggaagcgcggcggcagtccatccgagatcaggtgcttcaggggggcgat
ccgggtgccgaagcgaccgaaacccgctga

DBGET integrated database retrieval system