KEGG   Alicyclobacillus acidocaldarius subsp. acidocaldarius Tc-4-1: TC41_2260Help
Entry
TC41_2260         CDS       T01821                                 

Definition
(GenBank) Phosphotransferase system, phosphocarrier protein HPr
  KO
K11184  catabolite repression HPr-like protein
Organism
aad  Alicyclobacillus acidocaldarius subsp. acidocaldarius Tc-4-1
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PTS-HPr
Motif
Other DBs
NCBI-ProteinID: AEJ44163
UniProt: F8IFS9
Position
complement(2157759..2158022)
Genome map
AA seq 87 aa AA seqDB search
MVEKVLTVNLPQGLAARPAAEFVKRASSFSSQIRIGKNGHFVDAKSVLGVMSMAIARGES
VTLQAEGSDAERAVETLAELLSRDTFE
NT seq 264 nt NT seq  +upstreamnt  +downstreamnt
atggtggaaaaggtcctgaccgtcaatcttcctcaggggctcgcggcgcggccagcggcg
gagtttgtcaagcgggcgtcatcgttttccagtcagattcggattgggaaaaacggtcat
ttcgtcgatgcgaagagcgtcctcggcgtgatgtccatggccattgcgcgcggggaatcg
gtcaccctgcaggccgaggggagcgacgcagagcgggcggtagagacactcgcggaattg
ctgtcgcgcgatacgttcgagtga

DBGET integrated database retrieval system