KEGG   Alicyclobacillus acidocaldarius subsp. acidocaldarius Tc-4-1: TC41_2262Help
Entry
TC41_2262         CDS       T01821                                 

Definition
(GenBank) putative transcriptional regulator, PucR family
Organism
aad  Alicyclobacillus acidocaldarius subsp. acidocaldarius Tc-4-1
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: HTH_30 HTH_8 GspH HTH_1
Motif
Other DBs
NCBI-ProteinID: AEJ44165
UniProt: F8IFT1
Position
complement(2159282..2160355)
Genome map
AA seq 357 aa AA seqDB search
MNMEFEAELVSRFFAALGKPCAWISWTPSLPNAPLGEWVESPEGALYLRVGDRLGVDGTP
LAPGERAFLTWVLSSSRGQGDAEPVARLRQCAAEDLVAAAAGLACAEPIEQVAASLPLSA
CPAHLVAIEWTTRVGGAAEHRESAEMVKKVTEAYVEVGAWHLSSHLSMAIASVPRAALRH
AWLSLGHAEMDVRGISALAEQIASALRSEAMVDARVAVSGVIRTPQEAAAGVATLELARR
EAVRRNTEAAVFGDDPVRMALLWLDEPSRRAYLRAVSAISEEETQDWPAGWGEIAEAMVR
SNLNISEAARSLYMHRNTLLARIEKLRDVSGFDVRRGTDAFALLAAATLLRGQSALE
NT seq 1074 nt NT seq  +upstreamnt  +downstreamnt
atgaacatggaattcgaagcagagttggtgtcgcggttctttgctgccttgggaaaaccc
tgcgcgtggatctcgtggacaccgtcgctccccaacgcgcctctcggcgaatgggtggaa
agtccggagggcgcgctctacttgcgcgtcggggaccgtctcggcgtcgacggaacgccg
ctcgcgcccggcgaacgggcgtttttgacctgggtgctgtcttcgtctcgtgggcaaggg
gatgccgagcccgtggcacgccttcgccaatgcgccgcggaggatctcgtcgcagccgcc
gcagggctggcgtgtgccgagccgattgagcaggtcgccgcatccttgcctctctccgcg
tgcccggctcacctcgtggccatcgagtggacgacccgcgtcggcggcgcagcggagcac
cgagagagcgccgaaatggtgaagaaggtcaccgaggcgtacgtcgaggtcggggcttgg
cacctgtcttcccacctctcgatggccatcgcttcggttccacgagccgcgcttcgccac
gcctggctgtcccttgggcacgcggagatggacgtccgcggaatttcggcgctggcggaa
caaatcgcgagcgcgttgcgaagtgaggcgatggttgacgcgcgcgtggccgtctcgggc
gtcattcggacaccgcaggaggcagcggccggcgtggcgacgctcgagctagcgcggcga
gaggcggtccggcgaaacacggaggccgcagtgtttggcgacgaccctgtgcggatggcc
cttctatggctggacgagccgtcgagaagggcttatttgcgcgctgtgtcggccatttcg
gaggaagaaacccaggactggcccgcaggctggggtgagatcgccgaggcgatggtgcga
tccaatctgaacatcagcgaagcggcgagatcgctctacatgcaccggaacacgctgctc
gcgcgaatcgagaaactgcgggatgtgtcggggttcgacgttcgccggggcaccgatgcg
ttcgcgctcttggccgcggcgacccttcttcgggggcaatctgcactcgaatag

DBGET integrated database retrieval system