KEGG   Alicyclobacillus acidocaldarius subsp. acidocaldarius Tc-4-1: TC41_2264Help
Entry
TC41_2264         CDS       T01821                                 

Gene name
mqo
Definition
(GenBank) malate/quinone oxidoreductase
  KO
K00116  malate dehydrogenase (quinone) [EC:1.1.5.4]
Organism
aad  Alicyclobacillus acidocaldarius subsp. acidocaldarius Tc-4-1
Pathway
aad00020  Citrate cycle (TCA cycle)
aad00620  Pyruvate metabolism
aad01100  Metabolic pathways
aad01110  Biosynthesis of secondary metabolites
aad01120  Microbial metabolism in diverse environments
aad01130  Biosynthesis of antibiotics
aad01200  Carbon metabolism
Module
aad_M00009  Citrate cycle (TCA cycle, Krebs cycle)
aad_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:aad00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    TC41_2264 (mqo)
   00620 Pyruvate metabolism
    TC41_2264 (mqo)
Enzymes [BR:aad01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.5  With a quinone or similar compound as acceptor
    1.1.5.4  malate dehydrogenase (quinone)
     TC41_2264 (mqo)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Mqo DAO Pyr_redox_2 FAD_binding_3
Motif
Other DBs
NCBI-ProteinID: AEJ44167
UniProt: F8IFT3
Position
complement(2162071..2163717)
Genome map
AA seq 548 aa AA seqDB search
MIYTLYGLSKSVEWRGNRLFSARRCRSAEGRTVWFAPRVKAGSHQHKDGIDMDGKTRSDV
ALIGGGIMSATLGTLFRQLAPEWTITVFERLDEVAVESSNEWNNAGTGHSALCELNYTVE
KPDGSIDISKAIQVNEQFLVSRQFWSFLVRQGIIEHPRDFIVPVPHMSFVQGETNVAFLK
KRHQLLSQHPLFQGMEYSEDPERLREWIPLMMKDRKLDRPIAATWIASGTDVNFGALTRM
LFHYLEREGVDVQCGKEVQDLKRTRDGMWQLRVRDVKTGTTYEHVSKFVFVGAGGWSLLL
LQKSGIEEGKGIGGFPVSGLFMVCENPEIVRQHRAKVYGKAPVGAPPMSVPHLDSRVIGG
REYVLFGPFAGFSPRFLKTGSMLDLFKSVKLHNLSTLLAAGAKNASLTLYLIRQLMLTKK
QRMDELREFVPTARDEDWRLVVAGQRVQVIKRHPRGELQFGTEVVSAKDGSIAALLGASP
GASVVVSIMLEVIRKCFPDRLPEWENKIREMIPSYGVTLRDRPDLMRSIQAETAEVLGLH
QMEARTDA
NT seq 1647 nt NT seq  +upstreamnt  +downstreamnt
atgatttatactctatacggattgtcgaaatccgttgaatggcgcggaaaccgcttgttt
tcggcgcgaaggtgtcgcagcgccgaaggtcggacagtttggtttgcgccgcgtgtcaag
gcgggctcgcatcagcataaggatgggatcgacatggacggaaagacgagatcggatgtc
gccctgattggtggcggcatcatgagtgccacgctgggtaccttgtttcgacagcttgcg
cctgaatggaccatcaccgtgttcgaacgcctggacgaggtggctgtggaaagttccaac
gagtggaacaacgcgggtacaggccactctgcgctctgcgagctgaactacaccgtcgaa
aagccagatggaagcatcgacatctccaaggccattcaggtgaacgagcagttcctcgtt
tctcgccaattttggtcgttcctcgtgcgacagggcatcatcgaacatccgagagatttt
atcgtgcctgtgccgcacatgagcttcgtgcagggcgagaccaacgtggcgtttttgaag
aaacggcatcagttgttgtctcagcaccctctcttccaagggatggaatactctgaggat
cccgagcgcctccgggaatggattccgctgatgatgaaggatcggaagctggaccgcccg
attgccgctacgtggattgcatccggaacggacgtgaactttggcgcgctcacccggatg
ctgttccactacctggagcgcgaaggcgtagacgtgcagtgcgggaaagaggtccaggac
ctgaagcgcacgcgcgatggcatgtggcagctccgcgtgcgcgatgtcaagaccggcacc
acctatgagcacgtgtcgaagttcgtcttcgtcggggccgggggatggagtctactgctt
ctgcagaaatccggaattgaagaggggaagggcatcggcggtttcccagtgagcggcctt
ttcatggtttgcgagaatcccgagattgtccgccagcatcgcgccaaggtgtatggcaag
gctcctgtgggcgcgccccccatgtccgtgccacatctggactctcgcgtcatcggcggt
cgggagtacgtgttgtttggaccgtttgccgggttttcgccgcgcttcttgaagacgggc
tccatgctcgacctgttcaagtcggtcaagcttcacaatttgtcgacgctgctcgccgcg
ggcgcgaagaacgcttctctgacgctgtatctcatccgacagcttatgctgacgaaaaag
cagcgcatggacgagctgcgcgagttcgtgcccacggcgcgcgatgaggattggcgcctc
gtcgtcgcggggcagcgcgttcaggtcatcaagcgccatccgcgcggcgagcttcagttc
ggcaccgaggtcgtgagcgcgaaggacgggtccatcgcagcgctgctcggcgcgtcgccg
ggcgcttccgtcgtcgtgtcgattatgttggaggtcattcgcaagtgtttcccggaccgg
ctgccggagtgggagaacaaaatccgcgaaatgatcccgtcgtacggcgtcacgctgcgc
gacaggcccgatttgatgcgctccatccaggccgaaacggccgaggtcctggggctccat
cagatggaggctcggacggacgcgtga

DBGET integrated database retrieval system