KEGG   Alicyclobacillus acidocaldarius subsp. acidocaldarius Tc-4-1: TC41_2266Help
Entry
TC41_2266         CDS       T01821                                 

Gene name
sucA
Definition
(GenBank) 2-oxoglutarate dehydrogenase, E1 subunit
  KO
K00164  2-oxoglutarate dehydrogenase E1 component [EC:1.2.4.2]
Organism
aad  Alicyclobacillus acidocaldarius subsp. acidocaldarius Tc-4-1
Pathway
aad00020  Citrate cycle (TCA cycle)
aad00310  Lysine degradation
aad00380  Tryptophan metabolism
aad01100  Metabolic pathways
aad01110  Biosynthesis of secondary metabolites
aad01120  Microbial metabolism in diverse environments
aad01130  Biosynthesis of antibiotics
aad01200  Carbon metabolism
Module
aad_M00009  Citrate cycle (TCA cycle, Krebs cycle)
aad_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:aad00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    TC41_2266 (sucA)
  09105 Amino acid metabolism
   00310 Lysine degradation
    TC41_2266 (sucA)
   00380 Tryptophan metabolism
    TC41_2266 (sucA)
Enzymes [BR:aad01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.4  With a disulfide as acceptor
    1.2.4.2  oxoglutarate dehydrogenase (succinyl-transferring)
     TC41_2266 (sucA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: E1_dh Transket_pyr OxoGdeHyase_C 2-oxogl_dehyd_N
Motif
Other DBs
NCBI-ProteinID: AEJ44169
UniProt: F8IFT5
Position
complement(2165103..2167952)
Genome map
AA seq 949 aa AA seqDB search
MRVEEGFTMANEQPGSLQTFWHQFSGPNLAYLLEQYEQYLADPNAVPEDVRSLFAQYGDP
AQAVSASPIETQPVFGPQVSALSPRTLEAAAKAYQLAQAIRANGHLAADTDPLFAPEGSP
ELEPSTYGLVEADLASLPASVVGGPIAQTAPNALAAIEALRKAYCSDLGYEFAHLSSREE
RAWFEDQIENRRFHQPLTLDEAKALYELLARAQLFERFMHKRFVGQKRFSVEGVDALVPM
VDALAKMAVDAGFDHVFIGMAHRGRLNVLAHVLKKPYERIFSEFHAGNGMASDEELAEYM
LGWGGDVKYHMGWTRTFETANGRKARYVLSNNPSHLEFVDPVVEGMTRAAQDDRTRPGQP
VQDVHKAFPILVHGDAAFTGEGVVAETLNFSKIPGYYTGGTVHIIANNHLGFTADPEQGR
STRYASDIAKGYDLPVVHVSADNPEACLRAVRLAFLYRETFQKDVVIDLVGYRRWGHNES
DDPAMTQPVMYAKIASHPTVMEIYANELVSRGAFTAADLQKIDQAIDEELLQAYKKYPEI
HTPAAITDFSEPTEDASPVPLEELKEINRALLETPPDFTVYPKLKRILERRRDALDGGDI
DWAHAEALAFGTILRSGTPIRMSGQDSERGTFGQRHLVLHDANTNARYAPLQHLPGAKAS
FVVYNSPLSETAVIGFEYGYSVEAKDALVLWEAQYGDFANVGQPLFDNFIVAARSKWGET
SGLVLLLPHGFEGQAHEHSSGRVERFLQLAARNNIVVANVTTSAQYFHLLRRQAARLKNP
RPLVIMTPKSLLRNPLAASKPEDLTNGRFQPVLHFAKIGEGAQAVRRLILSSGKVGVDLA
AEMSKRGEEACAHVATARVEQLYPFPADRVKDVIASYPNLQEVVWLQEEPENQGPWNFMR
PRLQELLPASVKLRYIGRPEQGFVAEGSPDVHNRVQAEILAQALANDIH
NT seq 2850 nt NT seq  +upstreamnt  +downstreamnt
gtgcgcgtggaagaggggttcacaatggcgaacgaacaacctggatcattgcagacgttc
tggcatcagttctcagggccgaacttggcctacctgcttgagcagtatgaacagtatctc
gcggatcccaacgccgtgccggaggacgtgcgcagcttattcgcgcaatacggggatccg
gctcaggcggtatctgcttcaccgatagagacacaaccggtgttcggacctcaggtttcc
gctttgtcgcctcgcacgctggaggccgcggcaaaggcctaccagctggcgcaagccatc
cgcgcgaacggccatcttgcggcggatacggatccgctgtttgctcccgaaggttctccc
gaattggagccgtccacgtacggccttgtggaagccgatctcgcctctctacccgcttcg
gtggtgggaggccccatcgcgcaaaccgcgcctaacgcactcgcggccatcgaggcgctg
cggaaggcgtattgcagtgacctcggctacgagtttgcccatctttcgagccgcgaagaa
cgggcgtggttcgaggatcagattgaaaatcggcgtttccatcagccgctcacgctggac
gaagcgaaggcgctttacgagttgctggcgcgcgcgcagctgttcgagcggttcatgcac
aagcgcttcgtaggccagaagcggttctcggtcgaaggtgtcgacgcgctcgttcccatg
gtggatgcgcttgcgaagatggcagtagacgccggtttcgatcacgtcttcatcggcatg
gcacaccgcggccgattgaacgtcctcgctcacgtgctgaagaagccctacgagcgcatc
ttctccgagttccacgccggcaatggcatggcttcggacgaggaactcgcggagtacatg
ctcggctggggcggcgatgtgaagtaccacatgggctggacgcgcactttcgagactgcg
aacggccgaaaggcgcggtatgtgttgtcgaacaatccaagccacctggaattcgtcgat
cccgtcgtcgaaggcatgacgcgcgcggcgcaggacgaccgcacgcgtcccgggcagccc
gtccaggacgtgcacaaggcgtttcccatcctggttcacggggacgccgcgttcactggc
gagggtgtcgtggctgagacgctcaacttctcgaagatccccggctattacaccggcgga
acggtgcacatcatcgccaataaccacctcggtttcaccgcggacccggagcagggccgg
tcgacgcgttacgcgagcgacatcgccaaaggctacgatctgccggtggttcacgtctcc
gcggacaatccggaagcctgcctgcgtgcggtacgcctcgccttcctgtatcgcgagacg
ttccagaaggacgtcgtgattgacctcgtcgggtatcgccgttggggccacaacgagtcg
gacgatcccgcgatgacgcagccggtgatgtacgcgaaaatcgcctcccatccgactgtg
atggaaatctacgcaaacgagctcgtctcgcggggcgcgttcacggcagcggatctgcag
aaaatcgatcaggccatcgacgaggaattgctgcaggcctacaagaaatacccggagatc
cacacgcctgcggccatcacggacttctcggagcccacggaggacgcaagtcccgtacct
ctggaggaactgaaggagatcaaccgggctctcctggagacgccgcccgacttcaccgtg
tacccaaagctgaagcgtatcctggagcggcgccgagacgcgctcgacggaggcgacatc
gactgggcgcacgccgaagccttggcgtttggaaccatcctgcgatccggcacgcccatc
cgcatgtccggccaggattcggagcgcggaacgtttggtcagcgccacctcgtgctccac
gacgcgaacaccaatgctcgctacgctccgctccagcatctgccgggagccaaggcgagc
ttcgtcgtgtacaacagtccgctctcggagacggccgtgatcggattcgaatacggctat
tcggtggaagccaaggacgcgctcgtgttgtgggaagcgcagtacggcgacttcgccaac
gtcggtcagcccctctttgacaacttcatcgtggccgcgcggtcgaagtggggggagacc
tctgggctggtgctgcttttgccgcacgggttcgaggggcaagcgcacgagcattcgagt
ggccgcgtggagcgcttcctgcagctcgccgctcgcaacaacatcgtcgtggcgaacgtg
acgacctccgcgcagtacttccatctgctgcggcgccaggcggcacggctcaaaaacccg
cgtccgctcgtcatcatgacgccgaagagcttgctcaggaacccgcttgcggcctcgaag
ccggaagatctgaccaatggccggttccagccggttcttcacttcgccaagatcggggag
ggcgcgcaggcggttcgccgcctgattctctcgagtggcaaggtgggcgtcgatctcgcc
gcggagatgtccaagcggggcgaggaggcgtgcgcgcacgtggctaccgcgcgcgtcgag
cagttgtacccgttcccggcggatcgcgtgaaggacgtgatcgcgtcgtatcccaacctg
caagaggtggtgtggctccaggaggagcccgagaaccaggggccgtggaacttcatgcgg
ccgaggttgcaggaacttcttccggcgtcggtgaaactccgttatatcggccgtcccgag
cagggcttcgtggcggaaggatcgccggacgtgcacaaccgcgtgcaagctgaaattttg
gcgcaggcgttggcaaacgatatccactaa

DBGET integrated database retrieval system