KEGG   Alicyclobacillus acidocaldarius subsp. acidocaldarius Tc-4-1: TC41_2269Help
Entry
TC41_2269         CDS       T01821                                 

Definition
(GenBank) protein of unknown function DUF58
Organism
aad  Alicyclobacillus acidocaldarius subsp. acidocaldarius Tc-4-1
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DUF58 DUF11
Motif
Other DBs
NCBI-ProteinID: AEJ44172
UniProt: F8IFT8
Position
2170351..2171427
Genome map
AA seq 358 aa AA seqDB search
MIWLWLPLLIVMALWLWPRAFARAVSGRVEGFLTASRAEMNPGDEVSLCVTLVNRSWMPI
PLAEVEIELPPQLSFHCEQASRLGRVALSVLPRRQADIEFRAYAWRRGPAHPVQARAALS
EGLGLLDTHIALDNRVSLAVRPRQLRVGPHFPFAPSGWMTRESRAFPDETALRSVRPYVM
GDPVRHIHWRASARLGQLMVKEFFTTEAPDWAIVLSAQATDPYWAGALHPDTFDAMCEQA
LAIAQWLTRGGGRVDFATNAACGNRQRATIAWLSAEGVASLLAHAQPIATCDLDALATAL
ARSPSSPRHWIVLSPRAEGAAKSWTSRFGVQVTWISARPSAEEDRQDATVEASHDANR
NT seq 1077 nt NT seq  +upstreamnt  +downstreamnt
gtgatctggctgtggcttcccttgctcatcgtgatggccctttggctatggccgcgcgca
tttgctcgcgcagtctcggggcgcgtcgagggcttcctgaccgccagccgcgcggagatg
aaccccggtgatgaagtgagtctctgcgtgacgctcgtcaatcggtcctggatgcccatc
cccttggccgaggtcgagatcgagctgccgccacagctgtcctttcattgcgaacaagcg
tcgcgccttgggcgtgtggcgctctccgtcctcccacgtcgccaagcagacatcgagttc
cgcgcgtacgcttggcgtcggggcccagcccaccccgttcaggcgcgcgcggcactcagc
gagggattaggcctcctcgacacccacatcgccctggacaaccgggtgtccctcgcggtg
cggccccgccaactacgcgtgggaccacactttccattcgccccttccgggtggatgacc
cgcgaatcccgcgcgtttcctgatgagaccgcgctgcgcagcgtgcgaccctacgtcatg
ggcgatcctgtccgccacatccactggcgcgcatcggcgcggctcggccaactgatggtc
aaggaatttttcaccaccgaggcgccggactgggccatcgtcctgagcgcccaggcgacc
gatccttattgggcgggcgcgctccatcccgacacgtttgacgccatgtgcgagcaggcg
ctcgccatcgcgcagtggctcacgcgcggcggcgggcgcgtggatttcgccaccaacgcc
gcctgtgggaatcggcagcgggcgaccatcgcgtggctctctgcagagggcgtcgcatcc
ctgctcgcgcacgcccagcccatcgcgacgtgcgatctcgacgcgctggcgaccgcattg
gcgcgatccccttcgtcgccgcggcactggattgtcctgagcccacgcgcagagggcgcc
gcaaaaagctggacgtcccgttttggggttcaggtcacatggatttcggcccgtccatcc
gcggaagaagatcgtcaagacgcaaccgtggaggcttcacacgatgcgaacaggtaa

DBGET integrated database retrieval system