KEGG   Alicyclobacillus acidocaldarius subsp. acidocaldarius Tc-4-1: TC41_2277Help
Entry
TC41_2277         CDS       T01821                                 

Definition
(GenBank) Xylose isomerase domain protein TIM barrel
Organism
aad  Alicyclobacillus acidocaldarius subsp. acidocaldarius Tc-4-1
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AP_endonuc_2 AP_endonuc_2_N DUF4385 PAC2
Motif
Other DBs
NCBI-ProteinID: AEJ44180
UniProt: F8IG27
Position
complement(2178903..2179871)
Genome map
AA seq 322 aa AA seqDB search
MKLGIFTVLFSQMPFEEMLDHVAAAGVDAVEIGTGGYPGNAHCDREALLASPEKRSAFLN
AITSRGLEISALSCHNNPLHPNAEVRQKADQELRETIRLAAELGVKTVVTFSGCPGESER
SENPVWVTCPWPEEYSRVLEWQWKEKVIPYWTEMNRFAADHGVRIAIEAHPGFVVYNGET
LLRLREACGEQIGINFDPSHMFWQGIDPVEAVHALAPHRCIFHVHAKDTGFNKHNVARDG
VLDTKPYREELKRAWIFRTVGYGHDQQTWADLLSALQMNGYDGVISIEHEDSLMSIEEGF
QKAVAFLRPLVIREKLQQMWWA
NT seq 969 nt NT seq  +upstreamnt  +downstreamnt
atgaaactcggcattttcaccgtgctcttcagccaaatgccgttcgaagagatgctcgat
cacgtcgccgcggcgggcgtggatgcggtcgagatcggcacaggcggttaccccggaaac
gcgcactgcgatcgggaagcgctcctagcctctccggagaagcggtccgcattcctcaac
gccatcacctcgcgcgggctcgagatctcggcgctctcgtgccacaacaatccgctccat
ccgaacgcggaggtgcgccagaaggcggatcaggagctgcgcgagaccatccggttggcc
gcggaactcggcgtgaagacggtcgtcacgttctccggctgccccggagaatcggagcgc
tcggagaatcccgtctgggtcacctgcccgtggccagaggagtattcgcgcgtgctcgag
tggcagtggaaggagaaagtcattccgtactggacggagatgaaccggttcgcggccgat
cacggcgtgcgcatcgccatcgaggcgcaccctgggttcgtggtgtataacggagagacg
ctcctgcgcctgcgcgaggcgtgcggcgagcaaatcggcatcaactttgatccgagccac
atgttctggcaggggattgatcccgtcgaggctgtgcatgccctcgcgccgcaccggtgc
atcttccacgtgcacgcgaaggacacgggcttcaacaagcacaacgtggcgcgcgacggc
gtgctcgacacgaagccgtaccgcgaggagctgaaacgggcctggatcttccgcacggta
ggctatggacacgatcagcagacctgggcggatcttttgagcgccctgcagatgaacggg
tacgacggtgtcatctccatcgagcacgaggacagcctcatgtccatcgaagagggattc
cagaaggccgtcgcgtttttgcggccgctcgtgatccgcgaaaaacttcagcagatgtgg
tgggcctaa

DBGET integrated database retrieval system