KEGG   Alicyclobacillus acidocaldarius subsp. acidocaldarius Tc-4-1: TC41_2302Help
Entry
TC41_2302         CDS       T01821                                 

Definition
(GenBank) peptidase M3A and M3B thimet/oligopeptidase F
Organism
aad  Alicyclobacillus acidocaldarius subsp. acidocaldarius Tc-4-1
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Peptidase_M3 Peptidase_M3_N
Motif
Other DBs
NCBI-ProteinID: AEJ44203
UniProt: F8IG50
Position
complement(2197114..2198931)
Genome map
AA seq 605 aa AA seqDB search
MALRSRSEVPDYETWDLTPLFASVEAWEAAVRRVRQLADDLVEVASKSFGGPADVAHALA
LHDDMLRIGTDVERYAMSKFAEDATDQGAQRLMSMAQLALDRAGEAAESLVAALCRVPED
RLAAWREDEALRPYAPYFGEIDRERRHRLADEAEKVLAANSSAFSLPSGIYEAATGGDMR
FEPVLDSDGREVGVTPSALLMHIETSHDTVLRHRAYDSVVNGLRPYQHTLARSLGAKIRN
DVVAARLRGFSSVFEMLQSTRLGGTMAANQVPPEHYFMVQDVMMKELAPHMRRLAHLRKR
VMGLEKVRLCDTKAPFVRLTDAELTFDDARSLILEASLPLGDTYSDILRRAFEERWIYWA
RNRGNWNGAFCGESSVHPYVFSPFEGGMYGVFVMAHELGHAVHLRLACQNARPSNLSFSN
LFIETPSTLMEHMVANALIRRAEDDAARAKVRMMQMFTFHHDFVTHQTEAEILRRLYTIA
DRGEPLSTDVFRRVSREVLTDFWQDAVDLDEGADLYWMRQPHYYMGLYSYTYAVGLAAST
LLADRILAGDGEVLARWIEVLRVGGGKTPLELFAHVGLDMGQPEPYREAIRKVGEIVDEL
ERAFS
NT seq 1818 nt NT seq  +upstreamnt  +downstreamnt
atggcgctgaggtcgcgaagtgaagttccggattatgagacgtgggatttgacgcccctt
ttcgccagcgtggaggcgtgggaagcggcggtccggcgcgtgcgccagttggcggatgat
cttgtcgaagtggcctcgaagtcattcggtggcccggcggacgtggctcacgcgttggcg
ctgcacgacgacatgctgcgcatcggcaccgacgtggaacggtacgccatgagcaagttc
gcggaggacgccaccgaccagggggcgcagcggctgatgtcgatggcccagctcgcactg
gatcgcgcaggggaagcggcggaatcgctggtggcagcgctatgccgagttcctgaggac
cgcctcgccgcttggcgggaggacgaagccttgcggccgtatgccccgtattttggcgag
atcgaccgcgagcgcagacatcggctcgccgatgaagcagagaaggtgcttgccgccaat
tcgtcggccttttcgctgccttccggcatttacgaagcggcgacgggcggggatatgcgg
tttgagccggtcctggacagcgacgggcgggaagtgggggtgacgccatccgcgcttctc
atgcacatcgagacgtctcacgatacggtgctccgccatcgagcctacgacagcgtggtg
aatgggctccggccgtatcagcatacgctcgcgcggtcgcttggggcgaaaatccgaaac
gacgtggtggcggcgcgattgcgcggcttctcgagtgtgttcgagatgttgcagagcacg
aggctcggcggcacgatggcggctaatcaggtgcctccggagcactacttcatggtccag
gacgtcatgatgaaggaactcgcccctcacatgcgccgcctggcgcaccttcgcaaaagg
gtgatgggcctcgagaaggtgaggttgtgcgacacgaaggctccgttcgtgcgcctgacg
gacgcagaactcacgtttgacgacgcgcggtcgttgatcttggaggcatccctcccgctt
ggggacacatacagcgacattctgcggcgcgcgtttgaggaacggtggatttactgggcg
cgcaaccgcggcaactggaacggcgcgttttgcggggagtcgagcgtccatccgtacgtg
ttttcgccgtttgaaggcggcatgtatggcgtcttcgtgatggcgcacgagctcggccac
gccgttcacctccgcctcgcgtgtcagaacgcgcgcccctccaacctgtcgttctcgaac
ctgttcatcgagacgccgtccacgctcatggagcacatggtggccaacgcgcttatccgg
cgtgcggaggacgacgccgcccgcgccaaggtgcgcatgatgcagatgttcacgttccac
cacgacttcgtcacgcaccagacggaggccgagattctgcggcggctctacaccatcgcg
gatcgaggggagccgctgtcgaccgacgtctttcgccgcgtctcgcgcgaggtgctgacc
gacttctggcaggacgcggtcgatctcgacgaaggggcggatctctactggatgcgccag
ccacactactacatgggtttatattcgtatacgtacgcggtggggctcgcggcgtccacc
ctcctcgccgatcgaatcctcgcgggggacggcgaggtcctggcgcgctggatcgaggtg
ttgcgcgtgggaggcggcaagacgccgcttgagctgttcgcgcacgtcggcctcgatatg
ggacaacccgagccgtaccgcgaagccattcgcaaagtgggcgaaatcgtcgacgagttg
gagcgcgcgttctcctga

DBGET integrated database retrieval system