KEGG   Alicyclobacillus acidocaldarius subsp. acidocaldarius Tc-4-1: TC41_2303Help
Entry
TC41_2303         CDS       T01821                                 

Definition
(GenBank) Aldose 1-epimerase
  KO
K01785  aldose 1-epimerase [EC:5.1.3.3]
Organism
aad  Alicyclobacillus acidocaldarius subsp. acidocaldarius Tc-4-1
Pathway
aad00010  Glycolysis / Gluconeogenesis
aad00052  Galactose metabolism
aad01100  Metabolic pathways
aad01110  Biosynthesis of secondary metabolites
aad01120  Microbial metabolism in diverse environments
aad01130  Biosynthesis of antibiotics
Module
aad_M00632  Galactose degradation, Leloir pathway, galactose => alpha-D-glucose-1P
Brite
KEGG Orthology (KO) [BR:aad00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    TC41_2303
   00052 Galactose metabolism
    TC41_2303
Enzymes [BR:aad01000]
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.3  Acting on carbohydrates and derivatives
    5.1.3.3  aldose 1-epimerase
     TC41_2303
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aldose_epim
Motif
Other DBs
NCBI-ProteinID: AEJ44204
UniProt: F8IG51
Position
complement(2198950..2199948)
Genome map
AA seq 332 aa AA seqDB search
MANMPAVETTYGGERAIRLTHGPYEAYLLPGWGNLVALRDTARGFRFLREPEAEMDEFRK
APGRYGIPVLYPPNRYRDGKFTIAGRAYHLPVNEEATHNHLHGFFMRIEWPVVDMGEDEG
GAYVEMAHEVGEGHPVYAHWPHTFRFAIRYELSGAGLVQRVHIDNRGGEPMPVMLGFHTA
VNVPFSAASSADACSIQLTIGERWELDERKLPTGRFQPLNENEQKMPTGGADPFYEPMDN
HYTARPRDGHNRMVLTDARLGLAFVYDVDLKYRHWMVWNNNCCGTFFCPEPQTNMVNAPN
MDLPQDVTGLIVLAPGESFSARSRMYVEEVSH
NT seq 999 nt NT seq  +upstreamnt  +downstreamnt
gtggcgaacatgcccgcagtcgagacgacgtacggcggtgagcgcgcaatccgcctgacg
cacggcccatatgaggcctacctgttgccggggtggggcaatctcgtggcgctgcgcgac
accgcgcgcggctttcggtttctgcgcgagccggaggcggagatggacgagtttcgcaag
gcacctggccgatatggcattcctgtgctgtacccgccaaaccgatatcgggacggcaaa
ttcaccatcgcaggcagggcgtatcacctcccggtgaatgaggaggccacgcacaatcac
ctgcacggcttcttcatgcggattgaatggcctgtcgtcgacatgggcgaagacgaaggg
ggcgcgtacgtcgagatggcccacgaggtgggagaaggccatccagtgtacgcgcactgg
ccgcacacgttccggttcgccatccgctacgagctgtcgggcgcgggcctcgtgcagcgc
gtccacattgacaaccgcggcggcgagccgatgccggtgatgcttggcttccacaccgcg
gtgaatgtgccgttctccgcagcgtcgtcggccgacgcctgctccattcagctgactatc
ggcgagcgctgggaactcgacgagcgcaagctgccgacggggcggtttcagccactgaac
gagaacgaacaaaagatgccgacaggcggcgcagatccgttctatgagccgatggacaac
cattacaccgcgcgcccgcgagacgggcacaaccgcatggtcctgacggacgcgcgtctc
gggctcgcgttcgtgtacgacgtggatctgaagtaccggcactggatggtgtggaacaac
aactgctgcggcacgtttttctgcccggagccgcagacgaacatggtgaacgcgccgaac
atggatctgccacaggatgtgaccggccttattgtccttgcgccgggggaatcgttctcg
gcgcgaagccgcatgtacgtggaagaggtcagccactga

DBGET integrated database retrieval system