KEGG   Alicyclobacillus acidocaldarius subsp. acidocaldarius Tc-4-1: TC41_2310Help
Entry
TC41_2310         CDS       T01821                                 

Definition
(GenBank) hypothetical protein
Organism
aad  Alicyclobacillus acidocaldarius subsp. acidocaldarius Tc-4-1
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GT87
Motif
Other DBs
NCBI-ProteinID: AEJ44211
UniProt: F8IG58
Position
complement(2207154..2207516)
Genome map
AA seq 120 aa AA seqDB search
MRVWNTLVQLAQTKRLSTLIIGLLASAKLITDALGLPFITDPEINAIANAVASVVTVIAI
FMTHNKATSGPPASPSSGSAAGGGSGASSAGSVAGAGTEGSSPVQSPQQASDGFARPPGA
NT seq 363 nt NT seq  +upstreamnt  +downstreamnt
atgagagtttggaacacgttggtccaactggctcagaccaaacggctgagcacgctcatc
atcggcttattggcgtcggccaagctcatcacggacgcactcggccttcctttcatcacg
gatcctgagatcaacgccatcgccaacgcggtggcatcggtcgtcaccgtgatcgcgatc
ttcatgacgcacaataaagcgacgtctgggccacctgcctcgccgtcgagcggcagcgca
gccgggggtggatccggagcttcgtcggccggttcggtggcgggagccgggacggagggc
tccagtcctgtccagtcgccgcaacaggcgtccgatgggttcgcgcgtcctccgggggcg
tga

DBGET integrated database retrieval system