KEGG   Alicyclobacillus acidocaldarius subsp. acidocaldarius Tc-4-1: TC41_2311Help
Entry
TC41_2311         CDS       T01821                                 

Definition
(GenBank) short-chain dehydrogenase/reductase SDR
  KO
K00059  3-oxoacyl-[acyl-carrier protein] reductase [EC:1.1.1.100]
Organism
aad  Alicyclobacillus acidocaldarius subsp. acidocaldarius Tc-4-1
Pathway
aad00061  Fatty acid biosynthesis
aad00780  Biotin metabolism
aad01040  Biosynthesis of unsaturated fatty acids
aad01100  Metabolic pathways
aad01130  Biosynthesis of antibiotics
aad01212  Fatty acid metabolism
Module
aad_M00083  Fatty acid biosynthesis, elongation
Brite
KEGG Orthology (KO) [BR:aad00001]
 09100 Metabolism
  09103 Lipid metabolism
   00061 Fatty acid biosynthesis
    TC41_2311
   01040 Biosynthesis of unsaturated fatty acids
    TC41_2311
  09108 Metabolism of cofactors and vitamins
   00780 Biotin metabolism
    TC41_2311
  09110 Biosynthesis of other secondary metabolites
   00333 Prodigiosin biosyntheses
    TC41_2311
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01004 Lipid biosynthesis proteins [BR:aad01004]
    TC41_2311
Enzymes [BR:aad01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.100  3-oxoacyl-[acyl-carrier-protein] reductase
     TC41_2311
Lipid biosynthesis proteins [BR:aad01004]
 Fatty acid synthase
  Component type
   TC41_2311
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: adh_short adh_short_C2 KR NAD_binding_10 Epimerase Polysacc_synt_2 Sacchrp_dh_NADP DUF1776 Shikimate_DH 3HCDH_N ApbA
Motif
Other DBs
NCBI-ProteinID: AEJ44212
UniProt: F8IG59
Position
2207680..2208405
Genome map
AA seq 241 aa AA seqDB search
MAQSLKGWSAIVTGAGKGIGKAIAEHLAKEGVHLGLIARTESDLNRVADAIRSAYGVSVY
TQAADIADRVSIESAIGRLKEQLGSVDVLVNNAGTASFGTVVDMPVEEWERIIRVNLLGT
YYATRAVLPHMMERNRGHIVNISSTAGEKGSATTSAYSASKFGLLGFTESLMYEVRKHNI
RVIALLPSTVNTDLARNVGLKLGDEDHQMQPEDVAELVVDALRLPNRVLLKSATLIMTNP
Q
NT seq 726 nt NT seq  +upstreamnt  +downstreamnt
atggcacaatcgctcaagggatggagcgccatcgtcacgggcgctggcaaaggcattggc
aaggccatcgcggagcacctcgcgaaagagggcgtgcacctcgggcttatcgcccgaaca
gaaagcgacttgaaccgcgtggcggatgccattcgcagcgcctatggggtttccgtctac
acgcaagccgccgacatcgctgaccgcgtatccatcgaatcggccatcggccgcctcaaa
gaacaattgggatcggtcgacgtcctggtcaacaacgcgggtacagcgagctttggcact
gtcgtggacatgcccgtggaggaatgggagcgcatcattcgcgtcaacctgctggggacg
tattacgcgacgcgcgccgtgttgccgcacatgatggagcgcaatcgcggccacatcgtc
aacatcagctcgacggcaggcgaaaagggctctgccacgacgtcggcgtactcggcatcc
aaatttggcctgcttggtttcacggaatcgctgatgtatgaggtgcgaaagcacaacatt
cgcgtcatcgccctgttgccgagcaccgtgaacacggatttggcccgcaatgtgggtctc
aaactgggggacgaagatcatcagatgcaaccggaggatgtcgccgaactcgtggtcgac
gcgctccgcttgccgaaccgcgtgctgctgaaatcggcgacgctcatcatgaccaaccca
cagtaa

DBGET integrated database retrieval system