KEGG   Alicyclobacillus acidocaldarius subsp. acidocaldarius Tc-4-1: TC41_2313Help
Entry
TC41_2313         CDS       T01821                                 

Gene name
pyrP
Definition
(GenBank) uracil-xanthine permease
  KO
K02824  uracil permease
Organism
aad  Alicyclobacillus acidocaldarius subsp. acidocaldarius Tc-4-1
Brite
KEGG Orthology (KO) [BR:aad00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:aad02000]
    TC41_2313 (pyrP)
Transporters [BR:aad02000]
 Other Transporters
  Electrochemical potential-driven transporters [TC:2]
   TC41_2313 (pyrP)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Xan_ur_permease
Motif
Other DBs
NCBI-ProteinID: AEJ44214
UniProt: F8IG61
Position
2208749..2209984
Genome map
AA seq 411 aa AA seqDB search
MVILATDCSAHADSAPFITQEVIPLSAVLRKLPLSLQHVFAMFGATVLVPILTGLSPGAT
LVASGLGTLVFHAITRGKVPAYLGSSFAFIAPLTLYVTRHHAPGQAVTGLVSVSVVYFLF
ALIVRLVGFDRVRRAIPSVVVGPVVSIIGLSLATTAVTVDASTHWDVAIVTLAAAVACAI
AGPRALRIIPILVGIVIGYLYALARGLVHLGQAAAQTKWIEFPTFHVPEWSLAAIASMAP
IALVTMVEDLGHMFVLNEIIERDVTRDPGFGSILFGNGLATLISALLGGPAETTYAENLG
VLAMTRNFSSRIIQGAAVIAILLGLVGKVSAVIQSIPPAVVGGVGILLYGMIAAMGIRHM
IEAKVDLTKTKNLIVVAVIFIIGIGAPQNGIAMATVAGLLIYWLLPDRTAS
NT seq 1236 nt NT seq  +upstreamnt  +downstreamnt
gtggttatacttgccacggattgctccgcacatgcggattccgcgccattcatcacacag
gaggtcatcccattgagcgctgtcctgcgaaagcttccgctgtctctgcagcacgtcttc
gccatgtttggcgcaacggtgctcgtgccgattttgacgggattgagccctggtgcaact
ctcgtggcgagcggcctggggacgctcgtgttccacgccatcacacgcggcaaggtgcct
gcgtacctgggatcttccttcgccttcattgcgcctctcacgctttacgtcacgcggcac
cacgcacctgggcaggcggtcactggacttgtgagcgtgtccgtcgtgtacttcctcttt
gccctcatcgttcgcctggtgggtttcgatcgcgtccgccgcgccatcccgtccgtcgtc
gtgggccctgtcgtgtcgattatcggcctgtcgctggcgacgacagccgtcacagtggat
gcgtcgacccactgggacgtcgccatcgtgacgctggccgcggccgtggcgtgcgccatt
gcggggccgcgcgccttgcgcatcattcccattctcgtcggcatcgtcatcggatacctg
tacgccctggcccgcggattggttcacctcggacaagccgccgcgcaaacgaagtggatt
gagttccccaccttccacgtcccagagtggagcctggccgcgattgccagcatggcgccc
atcgcgcttgtgaccatggtggaggatctcggccacatgttcgtcctgaacgagatcatt
gagcgagacgtcacgcgcgatccggggttcggctccatcttgtttggcaacggactcgcg
accctgatttccgcgcttctcggcggacctgccgagacgacatacgcggagaatctgggc
gtcctggccatgacaaggaacttctcaagccgcatcattcagggcgcagccgtgatcgcc
atccttctcggccttgtcggcaaggtaagcgcggtgattcagtccatcccgccagcggtt
gtcggaggtgtcggtatcctgctgtacggcatgatcgcggcgatgggcatccggcacatg
attgaggccaaggtagacttgacgaagaccaagaacctcatcgtggtggcggtcatcttc
atcatcggaattggcgcacctcaaaacggaattgcgatggcaacggtcgccggcctgttg
atctactggctgctgcccgaccgcacagcatcctaa

DBGET integrated database retrieval system