KEGG   Alicyclobacillus acidocaldarius subsp. acidocaldarius Tc-4-1: TC41_2354Help
Entry
TC41_2354         CDS       T01821                                 

Gene name
ilvH
Definition
(GenBank) acetolactate synthase, small subunit
  KO
K01653  acetolactate synthase I/III small subunit [EC:2.2.1.6]
Organism
aad  Alicyclobacillus acidocaldarius subsp. acidocaldarius Tc-4-1
Pathway
aad00290  Valine, leucine and isoleucine biosynthesis
aad00650  Butanoate metabolism
aad00660  C5-Branched dibasic acid metabolism
aad00770  Pantothenate and CoA biosynthesis
aad01100  Metabolic pathways
aad01110  Biosynthesis of secondary metabolites
aad01130  Biosynthesis of antibiotics
aad01210  2-Oxocarboxylic acid metabolism
aad01230  Biosynthesis of amino acids
Module
aad_M00019  Valine/isoleucine biosynthesis, pyruvate => valine / 2-oxobutanoate => isoleucine
aad_M00570  Isoleucine biosynthesis, threonine => 2-oxobutanoate => isoleucine
Brite
KEGG Orthology (KO) [BR:aad00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00650 Butanoate metabolism
    TC41_2354 (ilvH)
   00660 C5-Branched dibasic acid metabolism
    TC41_2354 (ilvH)
  09105 Amino acid metabolism
   00290 Valine, leucine and isoleucine biosynthesis
    TC41_2354 (ilvH)
  09108 Metabolism of cofactors and vitamins
   00770 Pantothenate and CoA biosynthesis
    TC41_2354 (ilvH)
Enzymes [BR:aad01000]
 2. Transferases
  2.2  Transferring aldehyde or ketonic groups
   2.2.1  Transketolases and transaldolases
    2.2.1.6  acetolactate synthase
     TC41_2354 (ilvH)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ALS_ss_C ACT ACT_5 ACT_4 ACT_6
Motif
Other DBs
NCBI-ProteinID: AEJ44255
UniProt: F8IGH5
Position
complement(2245040..2245570)
Genome map
AA seq 176 aa AA seqDB search
MTPVLSVLVHNKPGVLNRITALFMRKGFNIQSLTVCITENPEISRMTIVMSDMDEAALEQ
VIKQLHKQIDVLKVTDLTDQAMVARELALIRVSSPIAERAIIHSLIEPFRANIVDVGRET
VTVQVTGDAEKIDALIALLRPYGIRELARTGLTALPREAASSADPKRAGEAQVLHI
NT seq 531 nt NT seq  +upstreamnt  +downstreamnt
atgacgcctgtcctgtccgtgctcgtgcacaacaaacccggcgtactcaaccgaatcacg
gcgctctttatgcgcaagggatttaacatccagagcctcaccgtctgcatcacggaaaac
ccggagatttcgcgcatgacgattgtcatgagcgacatggacgaggctgcgctggagcag
gtcatcaagcagcttcacaaacagattgacgtgctgaaggtgacggatctcacggatcag
gcgatggtcgcgcgagagctggcgctcatccgggtgtcgagccccatcgccgagcgcgcg
attatccattcgctcatcgagccgttccgggcgaacatcgtcgatgtcgggcgcgagacg
gtgacggtgcaggtgacgggcgatgcggagaaaatcgacgcgcttattgccctgctccgg
ccgtatggcattcgcgaattggcacgcacggggctgacggcgctgccgcgcgaggcggcg
tcctcggccgacccgaagcgcgccggagaggcgcaggtcctccacatctag

DBGET integrated database retrieval system