KEGG   Alicyclobacillus acidocaldarius subsp. acidocaldarius Tc-4-1: TC41_2356Help
Entry
TC41_2356         CDS       T01821                                 

Gene name
ilvD
Definition
(GenBank) dihydroxy-acid dehydratase
  KO
K01687  dihydroxy-acid dehydratase [EC:4.2.1.9]
Organism
aad  Alicyclobacillus acidocaldarius subsp. acidocaldarius Tc-4-1
Pathway
aad00290  Valine, leucine and isoleucine biosynthesis
aad00770  Pantothenate and CoA biosynthesis
aad01100  Metabolic pathways
aad01110  Biosynthesis of secondary metabolites
aad01130  Biosynthesis of antibiotics
aad01210  2-Oxocarboxylic acid metabolism
aad01230  Biosynthesis of amino acids
Module
aad_M00019  Valine/isoleucine biosynthesis, pyruvate => valine / 2-oxobutanoate => isoleucine
aad_M00570  Isoleucine biosynthesis, threonine => 2-oxobutanoate => isoleucine
Brite
KEGG Orthology (KO) [BR:aad00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00290 Valine, leucine and isoleucine biosynthesis
    TC41_2356 (ilvD)
  09108 Metabolism of cofactors and vitamins
   00770 Pantothenate and CoA biosynthesis
    TC41_2356 (ilvD)
Enzymes [BR:aad01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.9  dihydroxy-acid dehydratase
     TC41_2356 (ilvD)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ILVD_EDD
Motif
Other DBs
NCBI-ProteinID: AEJ44257
UniProt: F8IGH7
Position
complement(2247334..2249007)
Genome map
AA seq 557 aa AA seqDB search
MRSDMIKKGVDRAPHRALLYATGVKPRDLSKPFIGVCNSYVDIVPGHVHLREFAEVVKDA
IRQAGGVPFEFNTIGVDDGIAMGHIGMRYSLASRELIADSAETMINAHWFDGVFFIPNCD
KITPGMLMAAVRCNVPAVFVSGGPMEAGRSRTGRPLSLSSVFEGVGQYMSGQISEDDLLD
LERNACPTCGSCSGMFTANSMNCIMEMLGIALPGNGTLVATSKERHELIYEAAKHLIRMV
EQDIRPRDIITREAIDDAFALDMAMGGSTNTVLHLMAIAHEAGIDYSLSDINEIAKKVPY
LAKISPASEYSIQDVHRAGGVSAIIRELCEHTDVVHPDRITVTGKTLYEQVKDAKILDER
VIRPASNPYSREGGLSILFGNLAPDGAVLKVGAVDPDIQRFVGRAICFNSQDEAMEGINS
GKVQPGHVVVIRYEGPKGGPGMPEMLAPTSSIVGRGLGREVALITDGRFSGATRGICVGH
ISPEAGVGGPIALVEDGDEIEIDIPNRTITLRVSDEELAARRARYQPPAKEKLTGYLARY
QKLVTSANTGAVLTVDA
NT seq 1674 nt NT seq  +upstreamnt  +downstreamnt
atgagaagcgacatgatcaagaagggtgtggaccgggcgccacacagggccttgctgtat
gccacgggcgttaaacccagggatctgtccaaaccgtttatcggtgtgtgcaactcgtac
gtcgacatcgttccgggccacgttcatctccgtgaattcgcggaggtcgtgaaagatgcc
atccgccaggccggcggcgttccgtttgagttcaacaccatcggggtggacgacgggatt
gcgatggggcacatcggcatgcggtattcgctcgcgagccgtgagctcatcgccgattcg
gccgagacgatgatcaacgcccactggtttgacggcgtctttttcatccccaactgcgac
aagatcacgcctggcatgctcatggcggccgtgcgctgcaacgtgccggcggtgttcgtg
tccggcggtccgatggaagcgggcagatcccgcacgggtcgtccgctttccctcagttcc
gtcttcgaaggcgtgggccagtacatgagcggccagatttccgaagacgatctgctggat
ctggagcgcaatgcctgtcccacgtgtggctcgtgttccggcatgttcaccgccaactct
atgaactgcatcatggagatgttgggcatcgcactccccggcaacggcacgctggtcgcc
acgtccaaggagcggcacgagctcatctatgaggccgccaaacacctcatccgcatggtg
gagcaggacattcggccgcgcgacatcatcacccgcgaagccattgatgacgcgttcgcg
ctggatatggccatgggcggatcgacgaataccgtcctgcacctgatggccattgcacac
gaggcgggcatcgactattccctgagcgatatcaacgaaattgccaaaaaagttccgtat
ctcgcaaagatcagccctgcgtccgagtacagcatccaggacgtgcaccgcgctggcggc
gtctcggccatcatccgggagttgtgcgaacacacggacgtggttcacccggatcgcatc
acggtgacgggcaagacgctgtacgagcaagtcaaggacgcgaagatccttgacgagcgc
gtcatccgcccggcttcgaacccgtatagccgcgaaggcggtctgtccatcctgttcggc
aatctcgcgccagacggggcggtgctgaaagtcggtgcggtcgatcccgacatccagcgg
tttgtgggccgcgctatctgcttcaattcgcaggacgaggcgatggagggcatcaacagc
ggcaaggtgcaaccgggtcacgttgtggtcattcgctacgaagggccgaagggcgggccg
gggatgcctgagatgctggcgcccacgtcgtccatcgtgggacggggcctcggccgcgag
gtggccctcatcacggatggccgattctcaggggccacgcgagggatttgcgtcggccat
atctcgcctgaggcgggcgttggggggccgattgcgctcgtcgaggatggagacgagatt
gagattgacattccaaaccgcaccatcaccctgagggtgtcggatgaggaactggcagcg
cgcagggcgcgttatcagccgcccgcgaaagagaagctcacgggctacctcgctcgttat
cagaagctggtcacgtcggcgaacaccggtgcagtactgacggtggacgcatga

DBGET integrated database retrieval system