KEGG   Alicyclobacillus acidocaldarius subsp. acidocaldarius Tc-4-1: TC41_2358Help
Entry
TC41_2358         CDS       T01821                                 

Gene name
ilvE
Definition
(GenBank) branched-chain amino acid aminotransferase
  KO
K00826  branched-chain amino acid aminotransferase [EC:2.6.1.42]
Organism
aad  Alicyclobacillus acidocaldarius subsp. acidocaldarius Tc-4-1
Pathway
aad00270  Cysteine and methionine metabolism
aad00280  Valine, leucine and isoleucine degradation
aad00290  Valine, leucine and isoleucine biosynthesis
aad00770  Pantothenate and CoA biosynthesis
aad01100  Metabolic pathways
aad01110  Biosynthesis of secondary metabolites
aad01130  Biosynthesis of antibiotics
aad01210  2-Oxocarboxylic acid metabolism
aad01230  Biosynthesis of amino acids
Module
aad_M00019  Valine/isoleucine biosynthesis, pyruvate => valine / 2-oxobutanoate => isoleucine
aad_M00119  Pantothenate biosynthesis, valine/L-aspartate => pantothenate
aad_M00570  Isoleucine biosynthesis, threonine => 2-oxobutanoate => isoleucine
Brite
KEGG Orthology (KO) [BR:aad00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00270 Cysteine and methionine metabolism
    TC41_2358 (ilvE)
   00280 Valine, leucine and isoleucine degradation
    TC41_2358 (ilvE)
   00290 Valine, leucine and isoleucine biosynthesis
    TC41_2358 (ilvE)
  09108 Metabolism of cofactors and vitamins
   00770 Pantothenate and CoA biosynthesis
    TC41_2358 (ilvE)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:aad01007]
    TC41_2358 (ilvE)
Enzymes [BR:aad01000]
 2. Transferases
  2.6  Transferring nitrogenous groups
   2.6.1  Transaminases
    2.6.1.42  branched-chain-amino-acid transaminase
     TC41_2358 (ilvE)
Amino acid related enzymes [BR:aad01007]
 Aminotransferase (transaminase)
  Class IV
   TC41_2358 (ilvE)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aminotran_4
Motif
Other DBs
NCBI-ProteinID: AEJ44258
UniProt: F8IGH8
Position
complement(2249155..2250042)
Genome map
AA seq 295 aa AA seqDB search
MASQVFLDGDFISSDAASVSVFDHGLLYGDGVFEGIRAYDGNVFRLKPHIERLYRSAKSI
LLEIPYTQDELTELVCETVRRNHLSSAYIRLVVTRGSGDLGLNPYNCAKARVFIIAEQLS
MFPKALYEQGIRAITAATRRTRGDMLNPKIKSLNYLNNILIKMEAIHAGANEAIVLNNEG
YVVEGSGENIFIVRDGVLITPPAYLGALEGITRQAVMDLAPSLGLEVRQEPFTQHDVYVA
DEVFLTGTAAEIVPVVEVDRRAVGQGVPGPVTKRVHAAFQEIVRTDGVRIEAAHV
NT seq 888 nt NT seq  +upstreamnt  +downstreamnt
gtggcatcacaggtttttctcgacggcgattttatctccagcgacgcagccagcgtgtcg
gtgttcgatcacggcctcctttacggcgatggcgtcttcgaaggaatccgcgcatatgac
ggaaatgtattccgcctcaaaccgcacatcgaacgactttatcgttcggccaagtctatt
cttctcgagattccgtatacgcaggacgaattgacagagctcgtatgcgagaccgttcgg
cgcaatcatctgtcttcggcgtacatccgtctcgtggtcacgcgcggcagcggggacctg
gggctgaatccatacaactgcgcgaaggcccgcgtgttcatcatcgcggaacagctctcg
atgtttccgaaggcgctgtacgagcagggcatccgcgccatcacggctgccacgcggcgc
acgcggggcgacatgctcaatccgaagatcaagtcactcaactatctcaacaatatactc
attaaaatggaagcgattcatgcgggtgccaatgaagcgattgtcctcaacaacgagggc
tatgtggtagagggttccggcgagaacatcttcatcgtgcgcgatggcgttctcattact
cctccggcctatctcggggcgctcgagggcatcacgcgccaagcggtgatggatttggcc
ccttcactcggccttgaggtgcggcaagagccgttcacccagcacgacgtgtacgtggcg
gacgaggtgtttctcacagggacagcggcggagattgtcccggtggtcgaggtggaccgc
cgcgccgttggtcaaggcgttccggggccggtgacgaagcgggtgcatgcggcgttccag
gaaattgtacgcacggacggtgtgcgaattgaagcagcccacgtctga

DBGET integrated database retrieval system