KEGG   Alicyclobacillus acidocaldarius subsp. acidocaldarius Tc-4-1: TC41_2365Help
Entry
TC41_2365         CDS       T01821                                 

Gene name
cytR
Definition
(GenBank) transcriptional regulator, LacI family
  KO
K02529  LacI family transcriptional regulator
Organism
aad  Alicyclobacillus acidocaldarius subsp. acidocaldarius Tc-4-1
Brite
Transcription factors [BR:aad03000]
 Prokaryotic Type
  Helix-turn-helix
   LacI family
    TC41_2365 (cytR)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Peripla_BP_3 Peripla_BP_1 LacI Peripla_BP_4 SpoIIID HTH_31 TetR_N HTH_3 HTH_23 HTH_AsnC-type HTH_Tnp_ISL3 HTH_38 HTH_24 HTH_26 HTH_10 MarR_2 HTH_6
Motif
Other DBs
NCBI-ProteinID: AEJ44265
UniProt: F8IGI5
Position
complement(2256032..2257054)
Genome map
AA seq 340 aa AA seqDB search
MRATIRDVAKAAGVSAATVSRALNRPDLVDPETLERVRKVMEEMSYQPSAIARGLSARRS
DTLGLIVPGITDFFFNELYKGIDRASQQYGMKVLLYDSEHSRERAFEGFSILSGYQVSGI
IFTSKLVTEDYDPILQRLNIPVVLTLTQSAAKTPLTAFRIDEVRAMFDVVAYLVSRGHRQ
IAMIAGQIWDDWTGELRLEGYREGLRHFGIEYCEARVEFGQYRFDDGYQAMQRLLERIRD
VPFTAVCTASDEMALGAIRCLNDHGYRVPDDISVMGFDDLPIARMVTPRLTTVAQPFHEI
GEEAVKWLIRAASQPPSPSEIGDYLLPHRLVERESVRSVS
NT seq 1023 nt NT seq  +upstreamnt  +downstreamnt
ttgcgagcgaccatccgcgacgtcgccaaggcggcgggggtgtctgccgcgaccgtgtct
cgcgccctgaatcggccggacctggtcgatcccgagaccctcgaacgcgttcgcaaggtg
atggaagagatgtcgtatcagccgagcgccatcgctcgaggactatccgcgcgaagaagc
gacacgctggggctcatcgtgcccggcatcacggatttctttttcaacgagctctacaag
ggcattgatcgtgccagtcaacagtacggcatgaaggtcttgctgtacgactctgagcat
tcgcgcgagcgggcgtttgagggcttctccatcctcagcggctaccaggtgtcgggcatc
atcttcaccagcaaactggtgacggaggactacgaccccattcttcagcggctcaacatc
cctgtcgtcctcacgctgacgcagagcgccgcgaagacgccgctcaccgcctttcgcatc
gatgaagtgcgagccatgttcgacgtcgtggcgtacctggtgtccagaggacatcggcag
attgcgatgatcgctggacagatatgggatgactggactggcgagttgcgcttggaaggg
tatcgggaggggcttcgccatttcggaatcgagtattgcgaggcgcgcgtggagtttggg
cagtatcgttttgatgacggctatcaggccatgcagcgcttgctggagcggatccgagac
gtgcccttcacagcggtgtgcaccgcgtcggatgaaatggcgctcggcgcgatacgctgt
ttgaacgatcacggctatcgcgtgccagatgacatctctgtcatgggatttgacgatctg
cccatcgcgcgcatggtgacaccgaggcttacgacggtcgctcagccgtttcatgaaatc
ggtgaggaagctgtcaaatggttgattcgggcggcgtcacagcctccgtcaccttctgag
attggggattacttgttgccgcatcgcctagtagaacgcgagtccgttcgttccgtttcc
tga

DBGET integrated database retrieval system