KEGG   Alicyclobacillus acidocaldarius subsp. acidocaldarius Tc-4-1: TC41_2367Help
Entry
TC41_2367         CDS       T01821                                 

Definition
(GenBank) ABC-type molybdate transport system periplasmic component-like protein
  KO
K15495  molybdate/tungstate transport system substrate-binding protein
Organism
aad  Alicyclobacillus acidocaldarius subsp. acidocaldarius Tc-4-1
Pathway
aad02010  ABC transporters
Brite
KEGG Orthology (KO) [BR:aad00001]
 Environmental Information Processing
  Membrane transport
   02010 ABC transporters
    TC41_2367
Transporters [BR:aad02000]
 ABC Transporters, Prokaryotic Type
  Mineral and organic ion transporters
   Molybdate/tungstate transporter [MD:M00423]
    TC41_2367
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: SBP_bac_11 SBP_bac_1
Motif
Other DBs
NCBI-ProteinID: AEJ44267
UniProt: F8IGI7
Position
2258389..2259408
Genome map
AA seq 339 aa AA seqDB search
MSMRSTVSGAMAALMLLATGCGTSTTAENTAGGAASAAPSKPVPLSVFYAGSMTHVMEQV
IRPRVDQALHIDFQGEGAGSAELAHMITSKLANPDVFISASPAVDVNDLMGASNGNAARW
YATLATDELVIAYSPKSKEAGEFKLAAEGKVPWYKVLEMPGVRFGRTDPKLDPKGANTIL
MMKLAETYYHQPNLEKTILGSDENPAQVFPEEDLIAQLTSGQMDAVIAYKHEAIEWHVPY
ITLPSAINLGDPALAKDYAKVSWTPDGGGKTVKGAPILFTITVLTHAPHPEQAAAFVRYM
TVGPGHQILMQDGFTPTPIRFYGDLRSVPASLRAIEEHS
NT seq 1020 nt NT seq  +upstreamnt  +downstreamnt
atgtcgatgcgttccaccgtgagcggcgccatggccgctctgatgctcctggccacaggt
tgtggcacgtccacgaccgctgagaataccgccggcggagccgcctccgcagcgccatca
aagccggtgccgttatccgtgttttacgcgggctccatgacgcacgtgatggaacaggtg
attcgaccgcgggtggaccaggcgctgcacattgactttcaaggcgaaggggctggctcg
gcagaactggcccatatgatcacgtccaaactggcgaacccagacgtgttcatcagcgcc
tctcctgctgtcgacgtgaacgatctcatgggcgcgtccaacggcaacgccgcgcgctgg
tacgcgacccttgcgaccgacgagttggtcattgcgtattcgccgaagagcaaggaggca
ggcgagttcaaactcgcggcggaaggcaaagtgccttggtacaaggtgctggagatgccc
ggcgttcgctttgggcgcacggatcccaaactggacccgaagggcgccaacaccattctc
atgatgaagctggcggagacgtactaccaccagccgaacctggagaaaaccattctcggc
agcgacgaaaacccggctcaggtgttcccggaagaagatctcatcgcgcaactgaccagc
ggacagatggacgccgtgatcgcgtacaaacacgaggccatcgagtggcatgtgccgtac
atcaccctgccaagcgctatcaacttgggcgatccggccctggccaaagactacgccaag
gtctcgtggacgcccgatggcggcggaaagacggtgaaaggtgcgcccattcttttcacc
atcactgtactcacccatgccccacaccccgagcaggcagccgcgttcgtgcgatatatg
acggtgggaccaggccatcagatcttgatgcaggacggcttcaccccaacacccatccgg
ttctacggcgacctgcgaagcgtgccggccagcctgcgagccatcgaggagcactcgtga

DBGET integrated database retrieval system