KEGG   Alicyclobacillus acidocaldarius subsp. acidocaldarius Tc-4-1: TC41_2368Help
Entry
TC41_2368         CDS       T01821                                 

Gene name
cysT
Definition
(GenBank) binding-protein-dependent transport systems inner membrane component
  KO
K15496  molybdate/tungstate transport system permease protein
Organism
aad  Alicyclobacillus acidocaldarius subsp. acidocaldarius Tc-4-1
Pathway
aad02010  ABC transporters
Brite
KEGG Orthology (KO) [BR:aad00001]
 09130 Environmental Information Processing
  09131 Membrane transport
   02010 ABC transporters
    TC41_2368 (cysT)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:aad02000]
    TC41_2368 (cysT)
Transporters [BR:aad02000]
 ABC Transporters, Prokaryotic Type
  Mineral and organic ion transporters
   Molybdate/tungstate transporter [MD:M00423]
    TC41_2368 (cysT)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: BPD_transp_1 UCR_Fe-S_N
Motif
Other DBs
NCBI-ProteinID: AEJ44268
UniProt: F8IGI8
Position
2259413..2260195
Genome map
AA seq 260 aa AA seqDB search
MLRSLRTSALYAAGAVSVAYALWPIIRLAADAPPDAIVQAWRQPELLQAAATSLMSAALS
TALSVVLGVPAAFLLVRFRFPGKWLLETLLLLPLVLPPIVGGVALMDVFGPYTAIGSFAA
AHHLPLTLSVAGIVLAQWYVTSPFLVFTSRAGFAEIPKELHEAFRLDGADGWTTFWRLYV
PLAAGSILTGAALTFARALGEFGATMLMAYHPYSLPVYIWVQFTAGGVASMVPIASGIVM
ALAVGVAAVRLVGSRFVRRG
NT seq 783 nt NT seq  +upstreamnt  +downstreamnt
atgttgcggagcctgagaacgtctgcgctgtacgccgcgggtgccgtgtccgtggcgtac
gcgctctggcccatcatacggctcgccgccgacgcacctcccgacgctattgtccaggcg
tggcgccagccggaactgctgcaggccgcggccacgtccctgatgagtgccgccctttcg
acggcgctgtccgtggtccttggcgtgcctgcggcgttcctgcttgtcaggtttcgcttt
ccgggcaagtggttgctcgaaaccctgctgcttctgccgctcgtgctcccgcccatcgtc
ggcggcgtggccctcatggacgtgtttggcccctatacggccattggcagcttcgcagcg
gcgcaccacttgccgctcaccctctccgtggccggcatcgtgctggcccagtggtatgtc
acgagcccgtttctcgtgttcacatcgcgcgcgggattcgcggagatcccgaaggagttg
cacgaggcgtttcgcctcgacggggccgatggctggacgacgttttggcgcctgtacgta
ccgcttgcggcgggctctatcctgaccggcgccgcgctgaccttcgcgcgcgcccttggc
gaatttggcgccaccatgctcatggcgtaccacccgtacagcctgcccgtctacatctgg
gtgcagttcacggccggcggggtggcgagcatggtgcccattgcgtccggcatcgtgatg
gcgctcgccgtgggcgtggcggctgtccgactggtgggctccaggttcgtccgcagaggc
tga

DBGET integrated database retrieval system