KEGG   Alicyclobacillus acidocaldarius subsp. acidocaldarius Tc-4-1: TC41_2372Help
Entry
TC41_2372         CDS       T01821                                 

Definition
(GenBank) hypothetical protein
Organism
aad  Alicyclobacillus acidocaldarius subsp. acidocaldarius Tc-4-1
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DUF1722 Peptidase_C101
Motif
Other DBs
NCBI-ProteinID: AEJ44272
UniProt: F8IGJ2
Position
complement(2261512..2262030)
Genome map
AA seq 172 aa AA seqDB search
MSVPLLYQGCEALWRDTKYAVMARNYAYVRDLSASLRQARGDEQALRAWLYRLKRVEQEP
TTLPALRNTAHHLLGYWKDRLQPEERRRFAQRALDDPAGVIAELGYRVRRDGLVYLATSY
VFRDEPWNEAVFRYRGSVYRMTVDAQEALSAGDPSKVFIRIQSLGEEPERAT
NT seq 519 nt NT seq  +upstreamnt  +downstreamnt
gtgtcggttccactgctgtatcaagggtgcgaagcgctgtggcgcgacaccaaatacgcc
gtcatggcgcgaaactacgcgtacgttcgcgacttgtccgcgtcgcttcgccaagcgcgc
ggcgatgagcaggccctccgcgcttggctttatcgcctgaagcgcgtggaacaggaaccc
acgacgcttccagcgcttcgcaacacagcgcatcacctcctgggctattggaaggatcgg
ttgcagccagaggaacggcggaggttcgcgcagcgtgcattggacgatccggcgggcgtg
atcgcagaactcggctatcgcgtccgccgcgacggacttgtgtatctcgctacgtcctac
gtgtttcgcgacgagccctggaacgaggctgtgtttcgctatcgaggaagcgtctatcgg
atgacggtcgatgcgcaggaggcgttgtcggcgggcgatccgtcgaaggtgttcatccgt
attcaatcgttgggagaggagcccgaacgagcgacgtga

DBGET integrated database retrieval system