KEGG   Alicyclobacillus acidocaldarius subsp. acidocaldarius Tc-4-1: TC41_2375Help
Entry
TC41_2375         CDS       T01821                                 

Definition
(GenBank) hypothetical protein
Organism
aad  Alicyclobacillus acidocaldarius subsp. acidocaldarius Tc-4-1
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: YolD
Motif
Other DBs
NCBI-ProteinID: AEJ44275
UniProt: F8IGJ5
Position
2262857..2263117
Genome map
AA seq 86 aa AA seqDB search
MPKKKLTTVVEDPEPRINGFTEAEWHEISVLIGEAIEAESPIRITLKEQAWRQSSRGRAI
REGFEVVSALSGRFLRSGAAGADGQG
NT seq 261 nt NT seq  +upstreamnt  +downstreamnt
atgcccaaaaagaagctgaccaccgtcgtcgaagaccccgaacctcgcatcaacggtttt
accgaagcggagtggcacgagatctccgttctcatcggcgaagcgattgaagcggagagc
ccgattcggatcaccctcaaagagcaagcttggcgacaaagttctcgagggcgtgccatt
cgtgaaggattcgaggttgtatctgcgctcagcggaaggttcctccgttcaggtgccgct
ggagcggatggccaaggttga

DBGET integrated database retrieval system