KEGG   Alicyclobacillus acidocaldarius subsp. acidocaldarius Tc-4-1: TC41_2385Help
Entry
TC41_2385         CDS       T01821                                 

Definition
(GenBank) hypothetical protein
Organism
aad  Alicyclobacillus acidocaldarius subsp. acidocaldarius Tc-4-1
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Methyltransf_25
Motif
Other DBs
NCBI-ProteinID: AEJ44285
UniProt: F8IGK5
Position
complement(2268566..2268997)
Genome map
AA seq 143 aa AA seqDB search
MRLQEFYERMNKSFVEDAETFTRWEKHRSILAKYIRELLSLSDIKRILVVGSGNCYDLDL
HVFNEHEVVVTFIDIDAEATRRAIEDREPMLLQKANIIQMDILGWNDTLESIKAVFAQGD
TQEILRAFKQAPKEISSFRTKRR
NT seq 432 nt NT seq  +upstreamnt  +downstreamnt
atgagactgcaagaattctatgagcgcatgaacaaatcctttgtagaagatgccgaaacg
tttacacgatgggaaaaacaccgttccatattagccaaatacatccgcgagctattaagt
ctctctgacatcaagcgaatcttagtcgtcggatccggtaattgctacgatctcgattta
cacgtgttcaacgagcatgaggtcgttgtcacattcatcgacatcgacgctgaagcaaca
cgtcgagcaattgaagaccgggaacccatgttgcttcaaaaagcaaatatcatacaaatg
gacattttgggatggaatgatacgcttgaatccatcaaagcagtatttgcccagggagat
acgcaagagattcttcgtgcgttcaagcaagccccgaaagaaatttcgtcgttccgtaca
aagcgtagatga

DBGET integrated database retrieval system