KEGG   Alicyclobacillus acidocaldarius subsp. acidocaldarius Tc-4-1: TC41_2388Help
Entry
TC41_2388         CDS       T01821                                 

Gene name
cpaF
Definition
(GenBank) type II secretion system protein E
  KO
K02283  pilus assembly protein CpaF
Organism
aad  Alicyclobacillus acidocaldarius subsp. acidocaldarius Tc-4-1
Brite
KEGG Orthology (KO) [BR:aad00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:aad02044]
    TC41_2388 (cpaF)
   02035 Bacterial motility proteins [BR:aad02035]
    TC41_2388 (cpaF)
Secretion system [BR:aad02044]
 Type II secretion system
  Tight adherence (Tad) export apparatus
   TC41_2388 (cpaF)
Bacterial motility proteins [BR:aad02035]
 Pilus system
  Pilus assembly proteins
   TC41_2388 (cpaF)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: T2SSE AAA_29 FCD AAA_22
Motif
Other DBs
NCBI-ProteinID: AEJ44288
UniProt: F8IGK8
Position
complement(2270560..2271948)
Genome map
AA seq 462 aa AA seqDB search
MSVNVRDIEQIQQHMEQMLKGDPREDQEGFYEEVNQYHKRLMEAIRRRQEWWRDLPPRRA
AYAYLGKVAGEVGIPPKYREYVITMALNDMYSYGKIQHLIDDPLVSDIQVYGDHFTFYTK
AGKRHISTEGFMTNEEVYAFVQKKLSGTNYRFDMTNPSTDAILPDGYRMHVVGGPAGWTL
PEDEDGRRLEKDCLIVTIRKPLRNFTLEELRDLHTFDDLILLFFQWMQRLARSFVVVGGT
GSSKSTLMAALLGLVPKDRLSCIIEEMPELQPLCAWAARLYERAPNAEGRGAVRMAQQIV
NTLRMMFDNVYIGEVRTTPVIWEYFQAAATVTYQTGTTLHVAGFAHAGAAIRRMAALLSS
HESRPTPAMVGDLITMGVRHIISMRSVPEKGGKRVVEIAEVLPYEPREQRIPYVVIAKWD
PRKDTWAFHGITEQMVEEASLLGHTIAELPIQTHPNVQYVYL
NT seq 1389 nt NT seq  +upstreamnt  +downstreamnt
atgtccgtcaatgtgcgagacatcgaacaaatacagcagcatatggaacagatgctcaag
ggtgatccgcgggaagaccaggaagggttctacgaagaagtcaaccaatatcacaaacga
ctcatggaggccattcgccggaggcaggaatggtggcgggatctcccgccccgccgcgcg
gcgtatgcgtatctcggcaaggtggcgggtgaagtcggcatcccgcccaagtaccgcgag
tacgtcatcacgatggcgctgaacgatatgtactcgtatgggaaaattcagcatcttatc
gacgatccgctggtctccgacatccaggtgtatggagaccacttcacgttctacaccaag
gcggggaagcggcatatctccacggaaggcttcatgacgaacgaagaggtctacgccttc
gtgcagaagaagctctccgggacgaattaccgctttgatatgacgaacccgtccaccgac
gccattcttccggacgggtatcggatgcacgtggtcggcggcccggcgggctggacgctg
cctgaggacgaagacggcaggcgactcgaaaaggactgcctgatcgtcacgatccgcaaa
cccctccggaacttcacgctggaggaactgcgcgacctgcacaccttcgacgacctgatc
ttgctcttcttccagtggatgcaacgcctcgcgcggtcgtttgtcgtggtcggcggcacc
gggtcctcgaagtcgacgctgatggccgcgctcctcggcttggtgccgaaggacaggctg
tcgtgcatcatcgaggagatgccggagcttcagccgctctgcgcctgggccgctagactc
tacgagcgcgcgccgaacgcggaaggccgaggcgctgtgcggatggcgcagcagatcgtc
aacaccttgcggatgatgttcgacaacgtctatatcggcgaggtgcgaacgacgcctgtc
atctgggaatactttcaggccgcagcgaccgtcacgtaccaaacgggcacgacattgcac
gtagcgggcttcgcacacgcgggcgcggcgatccggcgcatggcggcgcttttgtccagt
catgagtctcggcccaccccagccatggtgggcgatctcatcacgatgggcgtgcgccat
atcatcagcatgcggtcggtgccggagaaaggcggcaagcgcgtggtcgaaatcgccgag
gtgctgccgtatgaaccgcgcgagcagcgcattccgtatgtcgtgatcgcgaaatgggat
ccgcgcaaggacacttgggccttccatggcatcacggagcaaatggtggaagaagccagt
cttctggggcatacgattgccgaacttccgatccagactcatcccaacgtgcagtacgtg
tatctctga

DBGET integrated database retrieval system