KEGG   Alicyclobacillus acidocaldarius subsp. acidocaldarius Tc-4-1: TC41_2390Help
Entry
TC41_2390         CDS       T01821                                 

Definition
(GenBank) Cobyrinic acid ac-diamide synthase
  KO
K04562  flagellar biosynthesis protein FlhG
Organism
aad  Alicyclobacillus acidocaldarius subsp. acidocaldarius Tc-4-1
Brite
KEGG Orthology (KO) [BR:aad00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02035 Bacterial motility proteins [BR:aad02035]
    TC41_2390
Bacterial motility proteins [BR:aad02035]
 Flagellar system
  Flagellar assembly proteins
   Regulation
    TC41_2390
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: CbiA AAA_31 CBP_BcsQ ArsA_ATPase ParA MipZ SRP54 DUF1611 VirC1 Fer4_NifH CLP1_P THF_DHG_CYH_C AAA_18 ArgK AAA_22 DUF87 AAA_26 Ish1 AAA_14 FTHFS
Motif
Other DBs
NCBI-ProteinID: AEJ44290
UniProt: F8IGL0
Position
complement(2272794..2273960)
Genome map
AA seq 388 aa AA seqDB search
MWLLCDHDPIRGERLHRYLDKQNVPSQIATKEDEIPEASSAYKLALFLGEWNPATVRRVK
ETLGVSVLYCTAENVRPERFEELRQQGYDDVVPYPPAVDYVRHWERTASDEERGGTTALE
KLVAGRRKRSYTELRETAPFAPPSTPITRKAKVICITGVKGGVGKTTTAVLLANALVAKR
KRIVVAELDPYGNLANLFRLERTVTTDRYETLPDALTEPELEQNMLRTPAGWWLIPKGDR
PLGLSKDGVSRLIHLVGMYADVLIVDTHAGHLVSTVIAMREADVVLGITTTDRTTWTDLR
AFLQMSERPAYLVLNRVRERPRKAASVGAFLQREIGFRVAAIVHEDDTLYRRVQQGLTPL
GSRKTNTKIHQLVNTLSIISKEAKPREA
NT seq 1167 nt NT seq  +upstreamnt  +downstreamnt
atgtggcttctatgtgaccacgacccgattcgcggcgagcggttgcaccgatacctggac
aaacagaacgtcccttcgcagattgccaccaaggaagacgagatcccggaggcgtcctcc
gcgtacaagctcgccttgtttctgggtgagtggaatccggcgacggtgcggcgcgtgaaa
gagacgctgggggtctcggtcctctactgcaccgccgagaacgtgcgcccggaacggttt
gaggaactgcggcaacaggggtatgacgacgtggtgccgtacccgccggccgtcgattac
gtgcggcactgggagcgcacggcctcagacgaggaacgtggcggaaccaccgcgctcgaa
aagctcgtggcggggcggcgcaaacgctcctatacggaacttcgtgaaaccgcgccgttc
gcgccgccgtctacgccgatcacgcggaaggcgaaggtgatttgcatcacgggggtcaag
ggcggagtcggcaagacgaccacggctgtcctcctcgccaatgcgctggtggcgaaaagg
aagcggattgtggtggcggagctcgacccttacgggaatctcgcaaatctgttccgcctg
gagcgcacggtcacgacggatcggtatgagactttgccggatgcgctcaccgagcccgag
ttggagcaaaacatgctcaggaccccagcgggatggtggcttattcccaaaggggatcga
ccgcttgggttgagcaaagacggcgtatcccggctgatccacttggtggggatgtacgcc
gacgttctgatcgtggacacgcatgccgggcacctcgtttccacggtcatcgccatgcgc
gaggcggatgtggtgttggggatcacgacgaccgaccgcacgacgtggacggatctacgc
gcctttctccaaatgagtgagcgcccggcctatctcgtgctgaaccgcgtccgggaacgc
ccgcgtaaagcggcgtctgtgggcgcgtttttacagcgggaaatcggctttcgggttgcg
gccatcgtccacgaagacgacacgctctatcgccgggtacaacagggtttgacgccgctt
ggctcccggaagaccaacactaagatccaccaacttgtgaacacgctctcgatcatctca
aaggaggcgaaacctcgtgaagcgtag

DBGET integrated database retrieval system