KEGG   Alicyclobacillus acidocaldarius subsp. acidocaldarius Tc-4-1: TC41_2875Help
Entry
TC41_2875         CDS       T01821                                 

Gene name
proC
Definition
(GenBank) pyrroline-5-carboxylate reductase
  KO
K00286  pyrroline-5-carboxylate reductase [EC:1.5.1.2]
Organism
aad  Alicyclobacillus acidocaldarius subsp. acidocaldarius Tc-4-1
Pathway
aad00330  Arginine and proline metabolism
aad01100  Metabolic pathways
aad01110  Biosynthesis of secondary metabolites
aad01130  Biosynthesis of antibiotics
aad01230  Biosynthesis of amino acids
Module
aad_M00015  Proline biosynthesis, glutamate => proline
Brite
KEGG Orthology (KO) [BR:aad00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00330 Arginine and proline metabolism
    TC41_2875 (proC)
Enzymes [BR:aad01000]
 1. Oxidoreductases
  1.5  Acting on the CH-NH group of donors
   1.5.1  With NAD+ or NADP+ as acceptor
    1.5.1.2  pyrroline-5-carboxylate reductase
     TC41_2875 (proC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: P5CR_dimer F420_oxidored ApbA Shikimate_DH PDH
Motif
Other DBs
NCBI-ProteinID: AEJ44766
UniProt: F8IK60
Position
complement(2735100..2735918)
Genome map
AA seq 272 aa AA seqDB search
MKRLFILGAGSMAESFIKGIVEEGVIDPRDIFVCNRSRRERLLELSEWYGITPAHSMARA
ADADLVILAVKPYDMMEVLKQLRPYLSDQVLLSFAAGVPIEAMQRATGGHPYIVRTMPNV
PVAVGMGAIALSAPSTVPRDKLRRVVEMLAGLGQVVEIEEGLMDAATAFSGSGPGFISYL
LEAMEQAAVELGFAPELARKLLVQTVIGTAHVLREWNLSPSELRRRVTSPNGTTHAGVEV
MQSQGVYQAIVEAVRRAAVRAEEMGREYTREG
NT seq 819 nt NT seq  +upstreamnt  +downstreamnt
ttgaagcggctttttatcctcggcgccggttcgatggccgagtcgtttatcaaagggatc
gtggaagagggcgtgatcgatccgcgggacatcttcgtctgcaaccgatcgcgccgcgag
cgattattggaattgagcgaatggtatggcatcacgcccgcccactcgatggcgcgggcg
gcggacgcggacctcgtcattctcgcggtgaagccgtacgacatgatggaggttttaaag
caactgcggccttatctgtcggatcaggtgctcttgtcgttcgccgcaggcgttcccatt
gaagccatgcagcgcgcgacgggagggcatccgtacatcgtccgcaccatgccgaacgtg
ccggtggcggttggcatgggcgccatcgcgctgtcggcgccttcgacggtgccgcgggac
aagcttcgccgagtcgtcgagatgttggctggcctcgggcaggtggtggagattgaggag
ggactgatggacgctgccaccgcgttttccggcagcgggccagggttcatcagctatctc
ctcgaggcgatggagcaggcggcggtggaactcggctttgcgccggaactcgcgcgaaag
cttctggtgcagacggtcatcggcacggcgcacgtcctgcgcgagtggaacctgagcccg
agcgaattgcgccgccgcgtgacgtcgccgaacggcaccacgcacgccggcgtcgaggtg
atgcagtcgcagggcgtgtatcaggccatcgtcgaggcggtgaggcgggcggctgtccgt
gcggaggagatggggcgcgagtacacgcgcgagggctga

DBGET integrated database retrieval system