KEGG   Alicyclobacillus acidocaldarius subsp. acidocaldarius Tc-4-1: TC41_2916Help
Entry
TC41_2916         CDS       T01821                                 

Definition
(GenBank) diguanylate cyclase/phosphodiesterase with PAS/PAC and MHYT sensor(s)
  KO
K21023  diguanylate cyclase [EC:2.7.7.65]
Organism
aad  Alicyclobacillus acidocaldarius subsp. acidocaldarius Tc-4-1
Brite
Enzymes [BR:aad01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.65  diguanylate cyclase
     TC41_2916
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: EAL GGDEF MHYT PAS_4 PAS_8
Motif
Other DBs
NCBI-ProteinID: AEJ44807
UniProt: F8IKP1
Position
2768599..2770968
Genome map
AA seq 789 aa AA seqDB search
MLVILSYVVASLAAYASLDLGRRVLETKANRQLVWVVLGGVAMGIGIWSMHFVAMLALML
PAQMTYNWAIVALSLMFAMAGPGAALYVVARSASPAKLAYGALLMGAGIVFMHYTGMAAM
AVQGGSFYYRAGPLALSVVIAVVASYVALWLSFRLATARGWLAHAAKVACALVMGIAISG
MHYTGMWATVFVLPTRRLAAPMAYSGPLAWVVAVFSAFILLAAIATVMLDRRLQADRRRL
RLADERFRSLYTHHSDAIFTLDARGAIVDQNPRAKELVPEHHLRKSARAFARMIDRRDRP
RVFEDYRWALRGSTTNGEFLLRAGDKALHMSATHIPIVLDDEIEGVFLVARDVTAEKVAA
ERMNYLAFHDTLTRLANRRHFEARVDEFIRHARPGDEMQILFVDLDRFKSVNDTLGHEFG
DKLLQEIARILKEVAGDDALVARMGGDEFTITLFGQPMERAIAVADAILNRLRKPVRVED
RPLYMTASLGIASFPRHGVTRDMLLRHADLAMYTAKAEGRSTYRLFEERTAADAKSRLEL
EQELRTAAQRGDFEIHYQPKIDMRAKSVVGVEALLRWRRPSGEYVPPCEFIPIAEETGLI
APIGEWCLRTACRQAKAWLDAGRPLRVAVNLSPYQVLTDGFLDVVREVLDETGLPAQYLE
IEVTESAMMDAERAERFLAGCQALGIEVSLDDFGTGYSSLSRLTHLPLNVVKIDRAFTQR
AVDGGRARALVASIVDIAHNLGMRCVAEGVETKEQLSVIEALGCDEAQGFYFARPLPPSD
LEALSITAG
NT seq 2370 nt NT seq  +upstreamnt  +downstreamnt
atgctcgtgatcctctcttatgtcgtcgcatcgctcgccgcgtacgcctcgctcgatctc
ggtcgccgcgtgctggaaaccaaggcgaatcgccagctcgtctgggtcgtgctcggcggc
gtcgcgatgggcatcggcatctggtccatgcactttgtggcgatgctcgctctcatgctc
cccgcgcagatgacgtacaactgggccattgtcgcgctttccttgatgtttgccatggca
ggccccggagcggcgctgtatgtggtggcgagatccgcgtcaccggcgaaacttgcatac
ggggccttgctcatgggcgcgggcatcgtgttcatgcactacacgggcatggccgccatg
gcggtgcaaggcggcagcttctactatcgcgctgggccgcttgcgctgtcggtcgtgatt
gccgtcgtcgcgtcatacgtggcgctctggctctcgttccggctcgctacggcgcgaggc
tggctcgcacatgcggccaaggtggcttgcgcgctcgtgatgggcatcgccatctcgggc
atgcattacaccggaatgtgggcgacggtattcgtcctgccgactcgccggctcgcggcg
cccatggcgtacagcgggccgctcgcatgggtggttgccgtgttcagcgcgttcatcctc
cttgccgccatcgcgaccgtgatgctggaccggcgactccaggcagaccgtcgccgcctg
cgtctcgcggacgagcggttccgctcgctctatacgcaccattcagacgccatcttcacg
ctcgacgcgcgcggcgccatcgtcgatcaaaatccccgcgcgaaggaactggtgcctgag
caccacctgcgcaaatccgcccgggcgttcgcgcggatgatcgacagacgggatcggccg
cgggtgttcgaggattaccgctgggcgcttcgcggcagcaccacgaacggcgagttcctg
cttcgggcgggagacaaggcgctgcacatgagtgccacgcacatccccatcgtgctcgac
gacgagatcgaaggcgtgtttctggtggcgcgcgacgtgacggcggagaaggtggcagcg
gagcgcatgaactacctcgcctttcatgacacgctaacgcgtctcgccaacaggcgccat
ttcgaagcgcgcgtggacgaatttatccgccacgcccgccctggcgacgagatgcagatt
ctctttgtcgatctcgaccgcttcaaatcggtcaacgacacgcttggacacgaatttggg
gacaagctgcttcaggagattgcccgcatcctgaaggaagtggccggcgacgacgcactc
gtggcccggatgggcggcgacgaattcaccatcacgctctttggccagcccatggagcgc
gccatcgccgtggcggacgccattttgaaccgcctacgcaagcctgtgcgcgtggaggat
cgcccgctgtacatgacggcgagcctcggcatcgcgagctttccgcgccatggcgtcacg
cgcgacatgttgctgcgccacgccgatctcgccatgtacacggcgaaagccgaggggcga
agcacgtaccgcttatttgaagagcgcacggcggccgacgcgaaaagccgcttggagctc
gaacaggaactccgcaccgcggcccagcgcggcgacttcgagattcattaccagccgaag
atcgacatgcgcgcgaagtcggtcgtgggcgtggaggctttgcttcgctggcgccggccg
agtggcgagtacgtgccgccgtgcgagttcatccctattgccgaggagacgggcctgatt
gcgcccatcggggagtggtgtctgcgcaccgcgtgccgccaggcgaaggcgtggctcgac
gccggtcgcccgctcagagtggcggtcaacctctcgccgtaccaggttttgaccgacggt
ttcctcgacgtggtgcgcgaagtcctcgacgagaccggcctgcccgcgcagtacctcgaa
atcgaggtgacggagagcgctatgatggacgccgagcgggctgaacggtttctcgccgga
tgccaggcgctcggcatcgaggtgtcgctcgacgacttcggcaccggctacagctcgctc
agccgcctgacgcacctgccactcaacgtggtgaagatcgatcgcgccttcacacagcgc
gcggtggatggcggccgggcgcgggccctcgtggcgagcatcgtggacatcgcacacaat
ctcggcatgcggtgcgttgcggaaggcgtggaaaccaaggaacagttgtccgtcatcgag
gcgctcggatgcgacgaggcgcagggattctacttcgcgcgtcccctccccccatccgat
ctcgaagcgctctcgatcacggcggggtaa

DBGET integrated database retrieval system