KEGG   Aquifex aeolicus: aq_063Help
Entry
aq_063            CDS       T00013                                 

Gene name
rpsF
Definition
(RefSeq) 30S ribosomal protein S6
  KO
K02990  small subunit ribosomal protein S6
Organism
aae  Aquifex aeolicus
Pathway
aae03010  Ribosome
Brite
KEGG Orthology (KO) [BR:aae00001]
 09120 Genetic Information Processing
  09122 Translation
   03010 Ribosome
    aq_063 (rpsF)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03011 Ribosome [BR:aae03011]
    aq_063 (rpsF)
   03029 Mitochondrial biogenesis [BR:aae03029]
    aq_063 (rpsF)
Ribosome [BR:aae03011]
 Ribosomal proteins
  Mitochondria/ Chloroplast
   Small subunit
    aq_063 (rpsF)
  Bacteria
    aq_063 (rpsF)
Mitochondrial biogenesis [BR:aae03029]
 Mitochondrial DNA transcription, translation, and replication factors
  Mitochondrial transcription and translation factors
   Other mitochondrial DNA transcription and translation factors
    aq_063 (rpsF)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Ribosomal_S6 NAS
Motif
Other DBs
NCBI-GeneID: 1192487
NCBI-ProteinID: NP_213034
UniProt: O66474
Structure
PDB: 

Position
40413..40745
Genome map
AA seq 110 aa AA seqDB search
MRHYKTLRYYETVFAVKPTLSEEEMKKKFEQVKEFIKQKGGEILYEEDWGMRQLAYPIQK
FNNARYFLVQFKTENPQLPNELDFQLKIDEDVIRWLNFQIKESEVKKNAQ
NT seq 333 nt NT seq  +upstreamnt  +downstreamnt
ttgaggcactacaaaaccttaaggtattacgagacagtttttgctgtgaagcccactctc
agcgaagaggagatgaagaagaagtttgaacaggtcaaggagtttatcaaacaaaagggc
ggtgagatactctacgaagaggactggggtatgagacaactcgcctaccccatacagaag
ttcaacaacgccagatacttccttgtgcagttcaagaccgaaaacccccaactccccaac
gagcttgacttccagctgaagattgacgaagacgtgataaggtggttaaattttcaaatt
aaggagagtgaagtaaagaaaaatgctcaataa

DBGET integrated database retrieval system