KEGG   Aquifex aeolicus: aq_1200Help
Entry
aq_1200           CDS       T00013                                 

Gene name
forG1
Definition
(RefSeq) ferredoxin oxidoreductase subunit gamma
  KO
K00172  pyruvate ferredoxin oxidoreductase gamma subunit [EC:1.2.7.1]
Organism
aae  Aquifex aeolicus
Pathway
aae00010  Glycolysis / Gluconeogenesis
aae00020  Citrate cycle (TCA cycle)
aae00620  Pyruvate metabolism
aae00633  Nitrotoluene degradation
aae00640  Propanoate metabolism
aae00650  Butanoate metabolism
aae00680  Methane metabolism
aae00720  Carbon fixation pathways in prokaryotes
aae01100  Metabolic pathways
aae01120  Microbial metabolism in diverse environments
aae01130  Biosynthesis of antibiotics
aae01200  Carbon metabolism
Module
aae_M00307  Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:aae00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    aq_1200 (forG1)
   00020 Citrate cycle (TCA cycle)
    aq_1200 (forG1)
   00620 Pyruvate metabolism
    aq_1200 (forG1)
   00640 Propanoate metabolism
    aq_1200 (forG1)
   00650 Butanoate metabolism
    aq_1200 (forG1)
  Energy metabolism
   00720 Carbon fixation pathways in prokaryotes
    aq_1200 (forG1)
   00680 Methane metabolism
    aq_1200 (forG1)
  Xenobiotics biodegradation and metabolism
   00633 Nitrotoluene degradation
    aq_1200 (forG1)
Enzymes [BR:aae01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.7  With an iron-sulfur protein as acceptor
    1.2.7.1  pyruvate synthase
     aq_1200 (forG1)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: POR
Motif
Other DBs
NCBI-GeneID: 1192602
NCBI-ProteinID: NP_213820
UniProt: O67256
Position
843356..844081
Genome map
AA seq 241 aa AA seqDB search
MTQPVRRRINVRMPAIGGQGAVSAAHIMATAADHAGYYAVSNPFYGAEKRMAPSESYVRI
GIEPIYDRGEVVYPDVIMVFHSQVITMGKSYTMPFYSGIKKNGLIIINAEEDLLSDEDKA
FLEERNVKIFNFSATKFAVEIAGTELATNMAMIGAFFGITQIVGMESIEEGIKARFLKKF
VASGGTASLDSAIERKFKKKLELIEKNIATARAAYEFANQWAKEQGIEPWLPKPEAVLQR
A
NT seq 726 nt NT seq  +upstreamnt  +downstreamnt
atgacacaacccgttagaagaaggattaacgttagaatgcccgctatcggtgggcagggt
gcggtttccgccgcccacattatggctaccgctgcggaccacgcagggtattacgcagtc
tccaaccccttctacggtgcagaaaagagaatggcaccctctgaaagttacgtgaggata
gggatagaacctatatacgacaggggagaagtcgtttatcccgacgttataatggtcttc
cactctcaggttataaccatgggtaaatcctacacaatgcccttctactcaggtataaag
aagaacggactcatcataataaacgcagaagaggatcttctttctgacgaagacaaggct
ttccttgaagagagaaacgtaaagatatttaacttctccgccacgaagtttgcagttgag
atcgcgggaacggaactcgccacaaacatggctatgataggagcattcttcggaattact
caaatagttggaatggagtccattgaagaaggtattaaggctaggttccttaaaaaattc
gttgcgtccggtggtactgcatctctggactcggctattgagagaaagttcaagaaaaag
ttagaactcatagaaaagaacatagctaccgcaagagcggcttacgagtttgccaatcag
tgggcaaaagaacaaggaatagaaccctggcttcccaagcctgaagctgttctccagagg
gcttaa

DBGET integrated database retrieval system