KEGG   Aquifex aeolicus: aq_1306Help
Entry
aq_1306           CDS       T00013                                 

Gene name
sucC1
Definition
(RefSeq) succinyl-CoA ligase subunit beta
  KO
K15232  citryl-CoA synthetase large subunit [EC:6.2.1.18]
Organism
aae  Aquifex aeolicus
Pathway
aae00720  Carbon fixation pathways in prokaryotes
aae01100  Metabolic pathways
aae01120  Microbial metabolism in diverse environments
aae01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:aae00001]
 09100 Metabolism
  09102 Energy metabolism
   00720 Carbon fixation pathways in prokaryotes
    aq_1306 (sucC1)
Enzymes [BR:aae01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.18  citrate---CoA ligase
     aq_1306 (sucC1)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ATP-grasp_2 Citrate_bind ATP-grasp_5 GARS_A DUF2226 ATP-grasp
Motif
Other DBs
NCBI-GeneID: 1192768
NCBI-ProteinID: NP_213894
UniProt: O67330
Position
924687..925997
Genome map
AA seq 436 aa AA seqDB search
MDLYEYEAYDKIFKKYGIPTPKYMFVEHITDDVVEFVNQLGECVVKSQVLVGKRGKAGAV
RVCSNPDEALEEIETLLRMTVYGEMPVGVLVVEKANILKELYASIVYSTDHRAPVLTLSL
EGGMDIEEVPPDKVKSWPINPLKGLYPHMVRNYLLELGFPHEYMPVLRKLSEVIARMWDA
FWGAEARLLEINPLAIVDRGGKPDVLALDAVVKIDDDASIPPAKIYGVRTALRRPPTERE
IAAAEIDKDDHRGKAGSYVELDGDIAMMTFGGGGSTVTIETCYELGLKPANLTDIGGNPP
AEKMYKITRIILSKPGIRAVLIAGGTANNTRIDVTLGEGVANALRDLKKEGKLDPNWIFV
VRRNGPEAEKGLRMLYEAFKECGIKGEIYDSALPLTEAPVRLKELLDKCQAKKLEEEEQI
KEGHTFTDEQASDLGM
NT seq 1311 nt NT seq  +upstreamnt  +downstreamnt
atggatctgtacgagtacgaagcgtacgataaaattttcaaaaagtacggtattcccacc
ccgaagtatatgttcgttgaacacattacagatgatgttgttgaattcgtaaatcaactg
ggtgagtgcgttgtaaagtcacaggttctagtaggaaagaggggaaaagccggagctgta
agggtatgctccaatcccgatgaagctttagaagagattgaaacactcctcaggatgact
gtttacggagaaatgcctgttggcgttctcgtagtggaaaaggcaaacatcctgaaagaa
ctttacgcttcaatagtttactccacggaccacagggcacccgtacttaccctcagcttg
gaaggcggaatggatatagaagaagttccccctgataaggtaaagtcctggccaataaac
ccgctaaaaggactctacccccacatggtgaggaattacctccttgaacttggatttccc
cacgaatatatgcccgttctcaggaagctctcagaagttatagcaagaatgtgggacgcc
ttctggggggctgaagcgagactccttgaaatcaacccccttgctattgtggacaggggc
ggaaagcctgacgttcttgcccttgacgcggttgttaaaatagacgacgacgcatcaata
ccgcctgcaaagatatacggagtgagaaccgcactcaggagacctcccacagaaagagaa
atcgcagccgcggaaatagacaaggacgaccacagaggaaaggcaggctcttacgtagaa
ctcgacggtgacatagctatgatgaccttcggaggaggaggttctaccgttacgatagaa
acgtgttacgaactcggactaaaacccgcaaacctcacggacataggcggtaacccgccc
gccgaaaagatgtacaagataacgaggataatactctccaaacccggaataagggctgtt
ctaatcgccggaggtactgcaaacaacacgagaatcgacgttactctcggtgaaggtgtt
gcaaacgcattaagagacctaaagaaagaaggaaaactcgaccccaactggatattcgtg
gtaaggagaaacgggccggaagctgaaaaaggactcagaatgctttacgaggcctttaaa
gagtgtggaataaagggagaaatttacgactccgcattgccgcttaccgaagctcccgtg
aggcttaaagaactcctcgataagtgccaagcaaaaaaacttgaagaagaagaacaaatt
aaggaaggacatacatttacggacgagcaagcttctgacctcggaatgtaa

DBGET integrated database retrieval system