KEGG   Aquifex aeolicus: aq_136
Entry
aq_136            CDS       T00013                                 

Gene name
cpx
Definition
(RefSeq) cytochrome C peroxidase
  KO
K00428  cytochrome c peroxidase [EC:1.11.1.5]
Organism
aae  Aquifex aeolicus
Brite
KEGG Orthology (KO) [BR:aae00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    aq_136 (cpx)
Enzymes [BR:aae01000]
 1. Oxidoreductases
  1.11  Acting on a peroxide as acceptor
   1.11.1  Peroxidases
    1.11.1.5  cytochrome-c peroxidase
     aq_136 (cpx)
SSDB
Motif
Pfam: CCP_MauG Cytochrom_C Cytochrome_CBB3 Glyco_hydro_15 Peptidase_M16_C
Other DBs
NCBI-GeneID: 1192676
NCBI-ProteinID: NP_213093
UniProt: O66533
Position
84354..85421
AA seq 355 aa
MRKGLLLMAVFAGFVVAKEKIDDKELLKMARQYFKPLPKVAENPQNPVTPEKVKLGKMLY
YDPRLSKSGLISCNTCHNLARYGVDNLPTSIGHRWAIGPRNAPTVYNAAIHIAQFWDGRA
KDVEEQALGPIVNPIEMANTEENAVKTLKSIPEYVELFKKAFPNEKDPVKYENIGKAIGA
FERTLMTPSRFDEFLKGNTKALTEQEKRGLKTFIEVGCVACHNGPGVGGNMFAKFGMITE
YWKVTYPYVLVGKPAIKVDFGRFGVTKKEEDMFVFKVPSLRNIEHTYPYFHDGSVWSLED
AVRIMAKTQLGKELTDQQVKDIVAFLKALTGKIPKHALEVPELPPSTDKTPKPEL
NT seq 1068 nt   +upstreamnt  +downstreamnt
atgagaaaaggtttactcctaatggcggtattcgcaggctttgtggtggcaaaggaaaag
attgacgacaaggaactccttaaaatggcaaggcagtacttcaaacccctccccaaagtt
gcggaaaatccccaaaatcctgttaccccagagaaggtaaagctcggaaagatgctctac
tacgatcccagactttcaaagagcggactaatcagctgtaacacctgtcacaacctcgcg
aggtacggagttgataacctcccgacttccataggacacaggtgggctattggaccaaga
aacgcacccacggtttacaacgccgcaatccacatagctcagttctgggacggaagggct
aaggacgttgaagagcaggctctcggacccatagtaaacccaatagaaatggcaaatacc
gaagaaaacgccgtaaagactttaaaatccatacccgaatacgtagaactcttcaaaaaa
gcgttccccaacgaaaaggatcccgttaagtacgaaaacataggaaaggcaataggtgcc
tttgaaagaactcttatgactccctcaaggtttgacgaattcctgaaaggaaacacgaaa
gctctaacagaacaagaaaagagaggactcaagacattcatagaagtggggtgtgtggct
tgccacaacggaccaggtgtaggcggaaacatgtttgctaagttcggaatgattaccgag
tactggaaagttacttatccttacgttctcgtaggaaaacctgcgataaaggttgacttc
ggtaggttcggtgtgacgaagaaagaagaagacatgttcgtattcaaagttccttccctc
aggaacatagaacacacgtacccctacttccacgacggaagcgtgtggagccttgaagac
gctgtaaggataatggcaaaaactcagctaggaaaagaactcacggaccagcaggttaaa
gatatagttgccttcctcaaagccctaaccggtaagataccaaagcacgcacttgaagtt
cccgaactacccccgtccacagacaaaaccccgaaacccgaactttaa

DBGET integrated database retrieval system