KEGG   Aquifex aeolicus: aq_1421Help
Entry
aq_1421           CDS       T00013                                 

Definition
(RefSeq) hypothetical protein
Organism
aae  Aquifex aeolicus
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: TusA DUF3343 DUF2249
Motif
Other DBs
NCBI-GeneID: 1192946
NCBI-ProteinID: NP_213980
UniProt: O67415
Position
1012351..1012944
Genome map
AA seq 197 aa AA seqDB search
MENVKEDRTLDLSGLSCPLPVVMTSETMRKMEEGQVLKVISTDPGFERDIWSWAKQSGNI
LLKVEKEDGKTIAYIKKASEAHEPSLWYWIKFHSLGVKLHIRQFCIQINPFVKKPTHFIT
FSAISEGTRAEKELKKLGEKDAVLIPIPDEIDPRCGVVLAVHGEKKAREIYEKLKDMDIA
VEAIYEKKGKEYERVYP
NT seq 594 nt NT seq  +upstreamnt  +downstreamnt
atggaaaacgtaaaggaagacaggaccttggatctatctgggctcagttgtcctctccct
gtcgttatgacatctgaaacgatgagaaaaatggaagaagggcaggttttaaaggtgatt
tccacggatccgggttttgagagggatatatggagctgggcaaagcaaagtgggaatata
cttctcaaggttgagaaagaagacggaaagacgatagcttacataaagaaggcaagcgag
gcacacgagccatcactctggtactggataaagttccactccttaggtgtaaagctccac
ataaggcagttctgtatacagataaaccccttcgtaaagaaacccacgcactttataacc
ttcagtgccatctccgaaggaacgagggctgaaaaagaactgaaaaaactcggtgagaaa
gatgcagttctgataccaattccggatgaaatagacccgaggtgcggagttgttctcgct
gttcacggcgagaaaaaggcaagggagatttacgaaaagttaaaggatatggacatagcg
gttgaagccatttacgaaaagaaaggaaaagagtacgagagagtttacccttaa

DBGET integrated database retrieval system