KEGG   Aquifex aeolicus: aq_1711Help
Entry
aq_1711           CDS       T00013                                 

Gene name
argF
Definition
(RefSeq) ornithine carbamoyltransferase
  KO
K00611  ornithine carbamoyltransferase [EC:2.1.3.3]
Organism
aae  Aquifex aeolicus
Pathway
aae00220  Arginine biosynthesis
aae01100  Metabolic pathways
aae01110  Biosynthesis of secondary metabolites
aae01130  Biosynthesis of antibiotics
aae01230  Biosynthesis of amino acids
Module
aae_M00844  Arginine biosynthesis, ornithine => arginine
Brite
KEGG Orthology (KO) [BR:aae00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00220 Arginine biosynthesis
    aq_1711 (argF)
Enzymes [BR:aae01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.3  Carboxy- and carbamoyltransferases
    2.1.3.3  ornithine carbamoyltransferase
     aq_1711 (argF)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: OTCace OTCace_N
Motif
Other DBs
NCBI-GeneID: 1193322
NCBI-ProteinID: NP_214173
UniProt: O67607
Position
1203752..1204672
Genome map
AA seq 306 aa AA seqDB search
MKRDFVDLWDLSPKEAWEIVKKTLKVKKGEEELGKPLSGKTIALLFTKPSTRTRVSFEVG
IYQLGGNSLFFQEKELQVSRGEDVRDTARTLSKYVDGVIVRNHSHTWLKEFANFASVPVI
NALTNMSHPCQILSDVFTLYEHYGEELKNLKVAYVGDGNNVCNTLMVGAGMFGLKLFVAT
PEGYEPNSYYYKKALEFSKENGGSVELTNNPVESVKDADVVYTDVWVSMGEENKNIEAFL
PYQVNEKLLSFAKSSVKVMHCLPAKKGQEITEEVFEKNADFIFTQAENRLHTQKTLMEFL
FREPQA
NT seq 921 nt NT seq  +upstreamnt  +downstreamnt
atgaaaagggactttgtagacctgtgggatttaagtcccaaagaggcatgggagatagta
aaaaaaaccctgaaagttaaaaagggagaagaagaacttggaaaaccgctttccgggaaa
acgatagcccttctcttcacaaagccctcaacgaggacaagggtttcctttgaagtggga
atttatcagctcggcgggaattccttattttttcaagagaaagagctacaagtttccagg
ggggaggacgtaagagataccgcaagaacactgtcaaaatacgttgacggggtgatagtg
agaaatcactcccacacgtggttgaaggagtttgcaaatttcgcgagcgttccggttata
aacgctttgaccaacatgtcccatccctgtcagatactgagtgatgtgttcacactttac
gaacactacggtgaggaacttaaaaacctaaaggtagcctacgtgggggacgggaacaac
gtgtgcaataccttaatggtcggggcggggatgttcggactgaaactcttcgtggcaacc
cctgaaggttacgagccaaattcctattactacaaaaaagcacttgagttttcaaaggaa
aacggcgggagcgtggaactaactaacaacccggtggaatcggtaaaagatgcggatgtc
gtttacacggacgtttgggtaagcatgggagaagaaaacaaaaacatagaagcgttttta
ccttatcaggtaaacgaaaaactcctctctttcgcaaagagttccgtcaaagtaatgcac
tgcctccctgcaaagaaagggcaggagattaccgaagaggtttttgagaagaacgctgac
tttatattcacgcaggcggaaaacagactgcacacacagaagacactcatggagttccta
ttcagagaacctcaagcttag

DBGET integrated database retrieval system