KEGG   Aquifex aeolicus: aq_1772Help
Entry
aq_1772           CDS       T00013                                 

Gene name
lpxC
Definition
(RefSeq) UDP-3-O-[3-hydroxymyristoyl] N-acetylglucosamine deacetylase
  KO
K02535  UDP-3-O-[3-hydroxymyristoyl] N-acetylglucosamine deacetylase [EC:3.5.1.108]
Organism
aae  Aquifex aeolicus
Pathway
aae00540  Lipopolysaccharide biosynthesis
aae01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:aae00001]
 09100 Metabolism
  09107 Glycan biosynthesis and metabolism
   00540 Lipopolysaccharide biosynthesis
    aq_1772 (lpxC)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01005 Lipopolysaccharide biosynthesis proteins [BR:aae01005]
    aq_1772 (lpxC)
Enzymes [BR:aae01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.108  UDP-3-O-acyl-N-acetylglucosamine deacetylase
     aq_1772 (lpxC)
Lipopolysaccharide biosynthesis proteins [BR:aae01005]
 Lipid A
  aq_1772 (lpxC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: LpxC
Motif
Other DBs
NCBI-GeneID: 1193363
NCBI-ProteinID: NP_214214
UniProt: O67648
Structure
PDB: 

Position
1250094..1250942
Genome map
AA seq 282 aa AA seqDB search
MGLEKTVKEKLSFEGVGIHTGEYSKLIIHPEKEGTGIRFFKNGVYIPARHEFVVHTNHST
DLGFKGQRIKTVEHILSVLHLLEITNVTIEVIGNEIPILDGSGWEFYEAIRKNILNQNRE
IDYFVVEEPIIVEDEGRLIKAEPSDTLEVTYEGEFKNFLGRQKFTFVEGNEEEIVLARTF
CFDWEIEHIKKVGLGKGGSLKNTLVLGKDKVYNPEGLRYENEPVRHKVFDLIGDLYLLGS
PVKGKFYSFRGGHSLNVKLVKELAKKQKLTRDLPHLPSVQAL
NT seq 849 nt NT seq  +upstreamnt  +downstreamnt
atgggattagaaaagacggttaaagagaaattaagctttgagggtgtcggtatacacaca
ggtgaatactcaaaattaatcatacatcccgaaaaagaaggaacaggaatcaggtttttc
aagaacggagtttacatacccgcaagacatgagttcgtcgttcacacaaatcactccacg
gatttaggctttaaagggcaaagaataaaaacggttgaacacatactttccgttctccac
ctacttgagataacaaacgtgacaatagaagtaatagggaacgaaatccctatacttgac
ggaagtggctgggaattctacgaagccattaggaaaaatattctcaatcagaacagagaa
atagattactttgttgtagaagaacccattatcgtggaagacgagggaagattgataaag
gcagaaccttcagacacgcttgaggtcacctacgagggagaatttaaaaatttcctggga
aggcagaagtttacctttgttgaagggaacgaagaagaaatagtccttgcgcggactttt
tgctttgactgggaaatagaacacattaaaaaagtcggtcttgggaagggaggaagcctg
aaaaacaccctcgttctcggaaaggataaagtgtacaaccctgaagggctaagatacgaa
aacgaacctgtaagacacaaagtgtttgaccttataggagacctttacctccttggaagt
cccgtaaaaggtaagttttactccttcaggggagggcactcgctcaacgtaaaactcgta
aaagagcttgcaaagaaacaaaaacttactcgtgatttacctcaccttccttccgtccaa
gctctctga

DBGET integrated database retrieval system