KEGG   Aquifex aeolicus: aq_1787Help
Entry
aq_1787           CDS       T00013                                 

Gene name
trpC
Definition
(RefSeq) indole-3-glycerol-phosphate synthase
  KO
K01609  indole-3-glycerol phosphate synthase [EC:4.1.1.48]
Organism
aae  Aquifex aeolicus
Pathway
aae00400  Phenylalanine, tyrosine and tryptophan biosynthesis
aae01100  Metabolic pathways
aae01110  Biosynthesis of secondary metabolites
aae01130  Biosynthesis of antibiotics
aae01230  Biosynthesis of amino acids
Module
aae_M00023  Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:aae00001]
 Metabolism
  Amino acid metabolism
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    aq_1787 (trpC)
Enzymes [BR:aae01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.48  indole-3-glycerol-phosphate synthase
     aq_1787 (trpC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: IGPS QRPTase_C NanE SOR_SNZ PDZ His_biosynth CPSase_L_D3 BKACE
Motif
Other DBs
NCBI-GeneID: 1193464
NCBI-ProteinID: NP_214223
UniProt: O67657
Position
complement(1260424..1261197)
Genome map
AA seq 257 aa AA seqDB search
MGFLEEVRSYKESQIDTSPEYLRKLEELIEERKEFYDFEKALTSCGTKIIAEVKKASPSE
GNIKEVNPEEQAKLYEKAGAIAISVLTDEKYFKGSLEDLRNVRESVKLPLLRKDFTVHKV
QILEAKAYGADIVLLIVRMLSDKELKELLDFSEELGLSPLVEVFTLDEAKRALDAGAKII
GINNRDLETFKVDINKTKELAPKIKDLGAKFVISESGISKREEILELMNYQVDGFLIGTS
LMKSENPYRKLKELLGF
NT seq 774 nt NT seq  +upstreamnt  +downstreamnt
atgggatttttagaagaggtaagatcttacaaagagagtcaaattgacacttccccggaa
tacctcaggaaacttgaagaattaatagaagagaggaaggagttttacgactttgagaaa
gccctcacgagttgcgggactaaaattatcgcagaagttaaaaaagcctccccttctgaa
gggaatataaaggaggttaacccggaagaacaggcaaaactctacgaaaaagctggggcg
attgcaatatccgttctgacggatgaaaagtacttcaaaggttctttagaggatttgaga
aatgtaagggaaagtgtaaaacttccgcttctgaggaaggacttcactgttcacaaagtt
caaatactggaagcaaaggcatacggtgcggacatagtcctcttaatagtgagaatgctc
tcagacaaggagttaaaggaattactcgatttttccgaggagctcggtctctcaccactc
gttgaggtattcaccttggacgaggcaaagagggcactcgacgccggagcaaaaattata
ggtataaacaacagggatctcgaaacgtttaaagttgatataaacaaaactaaggaactt
gcacccaagataaaggatctcggggcgaagttcgtgatttccgagagcgggatatccaaa
agggaggagatccttgaacttatgaattatcaggtggacggctttttaataggcacttcc
cttatgaagagtgagaatccttacaggaagttaaaagagttgctgggcttttga

DBGET integrated database retrieval system