KEGG   Aquifex aeolicus: aq_1960Help
Entry
aq_1960           CDS       T00013                                 

Gene name
thiD
Definition
(RefSeq) HMP-P kinase
  KO
K00941  hydroxymethylpyrimidine/phosphomethylpyrimidine kinase [EC:2.7.1.49 2.7.4.7]
Organism
aae  Aquifex aeolicus
Pathway
aae00730  Thiamine metabolism
aae01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:aae00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00730 Thiamine metabolism
    aq_1960 (thiD)
Enzymes [BR:aae01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.49  hydroxymethylpyrimidine kinase
     aq_1960 (thiD)
   2.7.4  Phosphotransferases with a phosphate group as acceptor
    2.7.4.7  phosphooxymethylpyrimidine kinase
     aq_1960 (thiD)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Phos_pyr_kin PfkB HK Carb_kinase PCMT
Motif
Other DBs
NCBI-GeneID: 1193669
NCBI-ProteinID: NP_214341
UniProt: O67772
Position
1377795..1378562
Genome map
AA seq 255 aa AA seqDB search
MIALSIAGFDNSGGAGTLADIRTFKHFGIYGVAVITALAVQNTQKVYEVFPIPPDVVKEE
LKAIFEDFPIKGVKIGMLANKEIAEVVYETLKSKKTNFIVLDPVFRSKSGRELLSEEGVE
FLKSEFIKIVDLITPNVPEAEILCGEEIKSLEDVKNCAQKIYSLGAKSVLIKGGHLKGNY
AIDILYDGKSFYEFKAPKIAGKTPRGTGCVYSSAILANYLRHKDLIKAIKTAKDFITEAI
KNSKKLGKGYEIMDF
NT seq 768 nt NT seq  +upstreamnt  +downstreamnt
atgatagccctcagtattgcagggtttgacaacagcggtggagcgggaaccttagcggat
ataagaacatttaagcacttcggtatttacggagttgccgtaataaccgccctggcggtt
caaaacacccaaaaggtttacgaggtatttcccattccgccggatgtagttaaggaagag
ctgaaagcaatatttgaggactttccgataaagggtgtaaagataggtatgcttgcaaat
aaagaaatagcggaagtggtttacgaaactcttaagagtaaaaaaacaaactttatagtt
cttgatcccgtttttcgttcaaagtcaggaagggaacttctttcagaagaaggggttgag
tttctaaaaagtgagtttattaaaatcgttgacctaattactccaaacgttccagaggca
gaaattctttgcggagaagagataaagagtttagaagacgtaaaaaattgtgcccaaaaa
atttattccttaggggctaaaagcgtgcttataaagggcgggcacttgaaaggaaactat
gcgatagatattctttacgacggaaagagtttttatgagtttaaagctcccaaaattgca
ggaaaaactccgagagggacgggttgtgtttattcctctgcaatccttgccaattacctg
aggcacaaagacctaataaaagcgataaaaacagcgaaagatttcattacagaagctata
aaaaacagtaaaaaactcggaaaaggctacgagattatggacttttga

DBGET integrated database retrieval system