KEGG   Aquifex aeolicus: aq_2109Help
Entry
aq_2109           CDS       T00013                                 

Gene name
hemB
Definition
(RefSeq) delta-aminolevulinic acid dehydratase
  KO
K01698  porphobilinogen synthase [EC:4.2.1.24]
Organism
aae  Aquifex aeolicus
Pathway
aae00860  Porphyrin and chlorophyll metabolism
aae01100  Metabolic pathways
aae01110  Biosynthesis of secondary metabolites
aae01120  Microbial metabolism in diverse environments
Module
aae_M00121  Heme biosynthesis, glutamate => heme
aae_M00846  Siroheme biosynthesis, glutamate => siroheme
Brite
KEGG Orthology (KO) [BR:aae00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    aq_2109 (hemB)
Enzymes [BR:aae01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.24  porphobilinogen synthase
     aq_2109 (hemB)
Exosome [BR:aae04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   aq_2109 (hemB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ALAD Radical_SAM
Motif
Other DBs
NCBI-GeneID: 1193865
NCBI-ProteinID: NP_214445
UniProt: O67876
Position
1485819..1486811
Genome map
AA seq 330 aa AA seqDB search
MIVGRFPSSRPRRLRRNENIRRLVRETHLTLDDLIYPIFVRWGENVVEEVPSMPGVYRYS
VDKVVDAVKEVRDLGIPAIILFGIPEHKDEVGSDTWSEEGIIQRALRKIKKEVPDIYVIT
DVCFCEYTTHGHCGVLHDHDVENDLTLENLKKQVVSHAENGADMVAPSGMMDGMVKVIRE
ALDEAGFKHIPIMAYSAKFASAYYGPFREAAESAPAFGDRRTYQMDPANSREALKEVLMD
VEEGADVVMVKPALAYLDIIAKVKENVLVPVCAYNVSGEYSLIKAAGKLGWIDEKKVMWE
TLLSIKRAGADMIITYFAKDAARMIIEGEV
NT seq 993 nt NT seq  +upstreamnt  +downstreamnt
atgattgtaggaagatttcccagttcaagaccgagaaggctcaggagaaacgaaaacata
aggaggctcgtgagggaaacccaccttacccttgacgacctaatataccccatattcgtg
aggtggggcgagaacgtagttgaagaagttccctccatgcccggcgtttacaggtacagt
gtagacaaggtagttgacgcggtaaaggaagtgagagatttaggaattcctgcgataatt
ctcttcggtattcccgaacataaagatgaagttggttcggacacgtggagtgaagagggg
ataattcagagagctttgaggaagataaagaaggaagttccggacatatacgtgattacg
gacgtttgtttttgtgaatacacaactcacggacactgcggagttcttcacgaccacgac
gtggaaaacgacctcacccttgaaaacttaaaaaagcaggtggtttcccatgcggaaaac
ggggcggacatggtggcaccttcgggaatgatggacggaatggtaaaggttataagggaa
gctctagacgaagctggctttaaacacatacctataatggcatactccgccaaatttgcc
tccgcttactacggacccttcagggaagccgcggagagtgctcccgcctttggagacagg
agaacttatcaaatggatcctgcaaactcaagggaagccctaaaagaggtcctgatggac
gttgaagagggtgcagatgtagttatggtaaaacccgccctcgcttacctcgacataata
gcgaaggtcaaggaaaacgttctggttcccgtgtgcgcttacaacgtgagcggtgagtac
tcccttataaaggccgcgggaaaacttgggtggattgacgagaagaaggttatgtgggaa
acactcctttccataaagagagcaggagcggatatgataataacttactttgcgaaggac
gcggcgagaatgatcattgagggtgaggtatga

DBGET integrated database retrieval system