KEGG   Aquifex aeolicus: aq_727Help
Entry
aq_727            CDS       T00013                                 

Gene name
ldhA
Definition
(RefSeq) D-lactate dehydrogenase
  KO
K03778  D-lactate dehydrogenase [EC:1.1.1.28]
Organism
aae  Aquifex aeolicus
Pathway
aae00620  Pyruvate metabolism
aae01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:aae00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    aq_727 (ldhA)
Enzymes [BR:aae01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.28  D-lactate dehydrogenase
     aq_727 (ldhA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 2-Hacid_dh_C 2-Hacid_dh NAD_binding_2 3HCDH_N IlvN
Motif
Other DBs
NCBI-GeneID: 1193388
NCBI-ProteinID: NP_213499
UniProt: O66939
Structure
PDB: 

Position
504614..505618
Genome map
AA seq 334 aa AA seqDB search
MNVLFTSVPQEDVPFYQEALKDLSLKIYTTDVSKVPENELKKAELISVFVYDKLTEELLS
KMPRLKLIHTRSVGFDHIDLDYCKKKGILVTHIPAYSPESVAEHTFAMILTLVKRLKRIE
DRVKKLNFSQDSEILARELNRLTLGVIGTGRIGSRVAMYGLAFGMKVLCYDVVKREDLKE
KGCVYTSLDELLKESDVISLHVPYTKETHHMINEERISLMKDGVYLINTARGKVVDTDAL
YRAYQRGKFSGLGLDVFEDEEILILKKYTEGKATDKNLKILELACKDNVIITPHIAYYTD
KSLERIREETVKVVKAFVKGDLEQIKGNFVVGPS
NT seq 1005 nt NT seq  +upstreamnt  +downstreamnt
atgaacgtattatttacaagtgttccacaggaagatgtacccttctaccaagaggcttta
aaggacctatcactaaaaatttacacaacagacgtttcaaaagtacccgaaaatgaatta
aaaaaagcggaactaatttcagtctttgtttacgataagcttacggaagaattactttcc
aagatgcctaggttaaagcttatccacacacgttccgtaggtttcgaccatatagactta
gattactgcaagaagaaaggcattctggttactcacatacctgcttattctcccgaatct
gtagctgaacacacctttgccatgatccttactctggtaaagaggctaaagaggatagag
gatagagtaaaaaaactgaacttttcgcaggatagcgaaattctggcacgggagttaaat
aggctcacgcttggagttatcggaaccggaaggataggaagtagagttgctatgtacggt
ttagcgtttggaatgaaggttctgtgttacgatgtcgttaagagggaggacttaaaagaa
aaaggatgtgtttacacctccctggatgaattactgaaggaaagcgatgttatttccctt
cacgttccgtatacgaaagaaacccatcacatgataaacgaagaaaggattagtttaatg
aaggacggtgtttatttgataaacaccgcgaggggaaaagttgtagatactgatgcactt
tacagagcctaccagaggggtaagttttcaggcttgggactggacgtatttgaggacgag
gaaatcttaatcctgaagaagtacacggaaggtaaggctactgataaaaacctgaaaata
ctcgaacttgcctgtaaagataacgtgataattactccccatatagcctattacacggac
aaatccttagagaggatcagggaagaaacagtaaaagttgttaaagcgttcgtgaaagga
gatctggaacaaataaaggggaactttgttgtaggtccttcctga

DBGET integrated database retrieval system