KEGG   Aquifex aeolicus: aq_960
Entry
aq_960            CDS       T00013                                 
Symbol
mbhL2
Name
(RefSeq) hydrogenase large subunit
  KO
K06281  hydrogenase large subunit [EC:1.12.99.6]
Organism
aae  Aquifex aeolicus
Pathway
aae00633  Nitrotoluene degradation
aae01120  Microbial metabolism in diverse environments
aae02020  Two-component system
Brite
KEGG Orthology (KO) [BR:aae00001]
 09100 Metabolism
  09111 Xenobiotics biodegradation and metabolism
   00633 Nitrotoluene degradation
    aq_960 (mbhL2)
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    aq_960 (mbhL2)
Enzymes [BR:aae01000]
 1. Oxidoreductases
  1.12  Acting on hydrogen as donor
   1.12.99  With unknown physiological acceptors
    1.12.99.6  hydrogenase (acceptor)
     aq_960 (mbhL2)
SSDB
Motif
Pfam: NiFeSe_Hases
Other DBs
NCBI-GeneID: 1193634
NCBI-ProteinID: NP_213655
UniProt: O67092
Position
complement(660510..662204)
AA seq 564 aa
MKRVVVDPVTRIEGHLRIEAEVKDGKITKAYSSGTMVRGIEIILKGRDPREAWAFAQRIC
GVCTTVHAIASVRAVEDALSINVPVNASLLRKLIIGTIFVHDHVVHFYHLHLLDWVNPVQ
ALKADPYETSRLAQSLSNYEKSTPGYFREVQKKIKQQVERGQLGIFNKGYWNHPEYKLPP
ELNLMLIAHYLDALDWQTRIVQVHTIIGGKNPHPNFAVGGMAAPINPESDTAINMEKLGR
IKTLIDEMYDFTVKVYLPDIKVLGKYYKDWFFKGEGLGNFLVLGEPEKDSWREGKWFIPP
TFIKGRNLKDFEEVNINEVKEYVTHSWYKYSVGDDKPLHPWEGETNLNYTGPKPPYEYLN
VEGKYSWLKAPRYKDYSVEVGPLSRILALYARDMYGIREEVEKHLKEMDVPFEGMFSTMG
RTFARALETKLYSFSMKNWFSELMENVKKGNYDVFNPEKWEPSTWPKETKGVGFMEAPRG
SLSHWVHIKDGKLENYQAVVPTTWNASPRDAKGNPSAYEASLVGHSLHNPKEPVEILRTI
HSFDPCLACAVHLYGDEEMEIRVV
NT seq 1695 nt   +upstreamnt  +downstreamnt
atgaaaagggttgtagttgatcccgtcacaaggatagagggacatttgaggatagaagcg
gaagtaaaagacggaaagataacgaaggcttacagctccggtacgatggtaagggggatt
gagataatccttaagggaagggatccacgggaagcgtgggcttttgcccagagaatatgc
ggtgtttgtacaacggtccacgcaatagcctcagtcagggcagtggaagacgcactttcc
ataaacgtccccgtaaacgcttccctccttaggaagttaataataggtactatattcgtt
cacgatcacgtagttcacttttaccaccttcacctcctcgactgggtaaatcccgtacaa
gctctaaaagcagatccttatgagacttcaaggcttgcccaatccttgtctaattacgaa
aaatccacacctggatatttcagggaagttcagaaaaagataaaacagcaggtagagagg
ggacagctggggatatttaacaaaggatactggaatcatcccgagtacaaacttccgcct
gaacttaacctcatgctcatagcccattaccttgacgcacttgactggcaaactaggata
gttcaagttcacacgataataggaggaaagaatccacacccgaactttgccgtaggaggt
atggcagctccaataaatccggaaagtgatacggccataaacatggaaaaactcggaaga
ataaaaacccttatagacgagatgtacgactttaccgtgaaggtttacctgcctgacatt
aaagttctagggaaatactacaaggactggttctttaaaggggaagggctcggaaacttc
ttagtgctcggagaaccggaaaaggactcctggagagaaggaaagtggttcataccacct
actttcataaaaggcagaaacctaaaggattttgaagaagtgaacataaatgaggtaaaa
gagtacgtcactcacagctggtacaaatactccgtgggtgacgacaaacccttacaccct
tgggaaggtgagactaatttgaactacacgggtcccaaacccccttatgaatacctcaac
gtcgaaggaaagtactcttggttaaaagctccccgttacaaggactactcggttgaagta
ggacctctttccagaattctcgctctgtatgcaagggatatgtacggtataagggaggaa
gttgaaaaacacttaaaggaaatggacgtacccttcgaaggaatgttttcaactatggga
agaactttcgcgagagcgctcgagacaaaactttactcctttagcatgaagaactggttt
tcggaactcatggaaaacgtcaaaaagggaaattacgacgtctttaatcctgagaagtgg
gaaccctcaacgtggccaaaggaaacaaaaggagtaggctttatggaagctcctagaggt
tctctatcccactgggtacacataaaagacggaaaactcgaaaattaccaggccgtagtc
cccacgacttggaacgcctctccgagagacgcaaagggaaatccatcggcttacgaggct
tccttagtagggcacagtctgcacaatcccaaggaacctgttgagattctcagaacaatc
cacagttttgatccatgtcttgcctgtgcagtacacctgtacggagacgaggagatggag
ataagggtagtttaa

DBGET integrated database retrieval system