KEGG   Aureococcus anophagefferens: AURANDRAFT_13416Help
Entry
AURANDRAFT_13416  CDS       T04134                                 

Definition
(RefSeq) hypothetical protein
  KO
K01408  insulysin [EC:3.4.24.56]
Organism
aaf  Aureococcus anophagefferens
Brite
KEGG Orthology (KO) [BR:aaf00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:aaf01002]
    AURANDRAFT_13416
Enzymes [BR:aaf01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.24  Metalloendopeptidases
    3.4.24.56  insulysin
     AURANDRAFT_13416
Peptidases and inhibitors [BR:aaf01002]
 Metallo peptidases
  Family M16: pitrilysin family
   AURANDRAFT_13416
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Peptidase_M16
Motif
Other DBs
NCBI-GeneID: 20218276
NCBI-ProteinID: XP_009032238
JGI: Auran1_13416
UniProt: F0XVC2
Position
Unknown
AA seq 160 aa AA seqDB search
VLVAEDDMVAPPLDARRYRLVALPNGMRALLVSDPGAETSAAALDVKVGFLSDPWDRPGL
AHFCEHMLFLGNAKYPAEGEWRSFLETRGGSSNAYTAAEDTCFYFDVDAGDFDAALDRFA
QFFVSPTFSASGVNRELEAIESEDSKNQQSDGFRLLQLDR
NT seq 480 nt NT seq  +upstreamnt  +downstreamnt
gtgctcgtagcggaggacgacatggtcgcgccgccgctcgacgcgcggcgctaccgactc
gtcgcgctgcccaacggcatgcgcgcgctgctcgtctcggacccgggcgcggagacgtcg
gcggcggcgctcgacgtcaaggtcggcttcctgagcgacccctgggaccggccgggcctc
gcgcacttttgcgagcacatgctcttcctcggcaacgccaagtacccggcggagggcgag
tggcggtccttcctcgagacgcgcggcgggtcgtcgaacgcgtacacggccgccgaggac
acgtgcttttacttcgacgtcgacgcgggcgacttcgacgcggcgctcgaccgcttcgcg
cagttcttcgtgagcccgacgttctccgcgtcgggcgtgaaccgcgagctcgaggccatc
gagtccgaggactcgaagaaccagcagtccgacggcttccggctgctccagctcgaccgg

DBGET integrated database retrieval system