KEGG   Aureococcus anophagefferens: AURANDRAFT_20571Help
Entry
AURANDRAFT_20571  CDS       T04134                                 

Definition
(RefSeq) hypothetical protein
  KO
K03841  fructose-1,6-bisphosphatase I [EC:3.1.3.11]
Organism
aaf  Aureococcus anophagefferens
Pathway
aaf00010  Glycolysis / Gluconeogenesis
aaf00030  Pentose phosphate pathway
aaf00051  Fructose and mannose metabolism
aaf01100  Metabolic pathways
aaf01110  Biosynthesis of secondary metabolites
aaf01130  Biosynthesis of antibiotics
aaf01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:aaf00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    AURANDRAFT_20571
   00030 Pentose phosphate pathway
    AURANDRAFT_20571
   00051 Fructose and mannose metabolism
    AURANDRAFT_20571
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:aaf04147]
    AURANDRAFT_20571
Enzymes [BR:aaf01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.11  fructose-bisphosphatase
     AURANDRAFT_20571
Exosome [BR:aaf04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   AURANDRAFT_20571
BRITE hierarchy
SSDB OrthologParalogGFIT
Other DBs
NCBI-GeneID: 20219316
NCBI-ProteinID: XP_009033201
JGI: Auran1_20571
UniProt: F0XYF8
Position
Unknown
AA seq 84 aa AA seqDB search
RTLLYGGVFYYPADKKSAKGKLRVLYEGYPMALLTEQAGGVASTGRFRGKAGRIMDVVPE
NIHDRCPIIMGCPRDVAMILSKYN
NT seq 255 nt NT seq  +upstreamnt  +downstreamnt
cgcacgctgctctacggcggcgtcttctactacccggcggacaagaagagcgccaagggc
aagctccgcgtgctctacgagggctaccccatggcgctcctcacggagcaggccggcggc
gtcgcgtcgacgggccgcttccgcggcaaggccggccgcatcatggacgtcgtcccggag
aacatccacgaccgctgccccatcatcatgggctgcccccgcgacgtcgccatgatcctc
agcaagtacaactag

DBGET integrated database retrieval system