KEGG   Aureococcus anophagefferens: AURANDRAFT_21222
Entry
AURANDRAFT_21222  CDS       T04134                                 

Definition
(RefSeq) hypothetical protein
  KO
K18458  N-acyl-aromatic-L-amino acid amidohydrolase [EC:3.5.1.114]
Organism
aaf  Aureococcus anophagefferens
Brite
KEGG Orthology (KO) [BR:aaf00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    AURANDRAFT_21222
Enzymes [BR:aaf01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.114  N-acyl-aromatic-L-amino acid amidohydrolase
     AURANDRAFT_21222
SSDB
Motif
Pfam: AstE_AspA
Other DBs
NCBI-GeneID: 20219411
NCBI-ProteinID: XP_009033981
JGI: Auran1_21222
UniProt: F0XZC9
Position
Unknown
AA seq 320 aa
MRYVLTFLRLCLLRAVACKRIVVVGGTHGNEYTGVYLVKALLATPALDNVEPFLANTRAI
ALNRRFCDEDLNRCFSRARLDTPRDTVEAARAAEIDAALGPKGSPAAADLVVDLHTTTAN
MGTTIIVDAWCPFALRCAAYVQARLAGVRILFNDIRDKAASPYLASVGADALQIEVGPTP
QGLVRADVVAATRAALEAVVEFATLDGDDVALPETVMAFSTAGSHAKLAWPVDADGFPTA
VVHEALQDRDWAPLAAGDGLFRTFDGAEVPYDGSLGDPVYPIFINEAGYYYASSGRGIGL
AKKLTLRVPRRGAAACEAAD
NT seq 963 nt   +upstreamnt  +downstreamnt
atgcgctacgtgctcaccttcctgcgcctgtgcctgctgcgcgccgtcgcctgcaagcgc
atcgtcgtcgtgggcggcacgcacggcaacgagtacacgggcgtgtacctcgtcaaggcg
ctgctcgccacgccggcgctggacaacgtcgagcccttcctggcgaacacgcgggccatc
gcgctgaaccggcgcttctgcgacgaggacctgaaccggtgcttttcgcgggcgcggctc
gacactcccagagacaccgtcgaggccgcgcgcgcggcggagatcgacgcggcgctcggg
cccaaggggtcgcccgccgccgcggacctcgtcgtcgacctccacacgacgacggcgaac
atgggcacgacgatcatcgtcgacgcgtggtgccccttcgcgctgcgctgcgcggcctac
gtccaggcgcggctcgccggcgtgcgcatcctcttcaacgacatccgcgacaaggccgcg
tcgccctacctcgcgtccgtcggcgccgacgcgctccagatcgaggtcggcccgacgccc
cagggcctcgtgcgcgcggacgtcgtcgcggcgacgcgcgcggcgctcgaggccgtcgtc
gagttcgcgaccctcgacggcgacgacgtcgcgctgccggagaccgtgatggcgttctcc
acggccgggtcgcacgcgaagctcgcgtggcccgtcgacgccgacggcttcccgacggcc
gtcgtccacgaggcgctccaggaccgcgactgggcgcccctcgccgcgggcgacggcctc
ttccggaccttcgacggggccgaggtgccctacgacgggagcctcggcgacccggtctac
cccatcttcatcaacgaggcgggctactactacgcgtccagcggccgcggcatcggcctc
gcgaagaagctcacgctccgcgtgccccggcgcggcgccgcggcctgcgaggccgccgac
taa

DBGET integrated database retrieval system