KEGG   Aureococcus anophagefferens: AURANDRAFT_26387Help
Entry
AURANDRAFT_26387  CDS       T04134                                 

Definition
(RefSeq) hypothetical protein
  KO
K08867  WNK lysine deficient protein kinase [EC:2.7.11.1]
Organism
aaf  Aureococcus anophagefferens
Brite
KEGG Orthology (KO) [BR:aaf00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:aaf01001]
    AURANDRAFT_26387
   01009 Protein phosphatases and associated proteins [BR:aaf01009]
    AURANDRAFT_26387
Enzymes [BR:aaf01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     AURANDRAFT_26387
Protein kinases [BR:aaf01001]
 Serine/threonine kinases: Other
  Wnk family
   AURANDRAFT_26387
Protein phosphatases and associated proteins [BR:aaf01009]
 Protein serine/threonine phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     AURANDRAFT_26387
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pkinase Pkinase_Tyr Pkinase_fungal
Motif
Other DBs
NCBI-GeneID: 20220204
NCBI-ProteinID: XP_009037049
JGI: Auran1_26387
UniProt: F0Y9K5
Position
Unknown
AA seq 243 aa AA seqDB search
RRYDSVEGIEVAWNVVNLKTMPPNEKARVINEVRLLDRLEHENIIDFHGSWVNRERGEVC
FITEILSSGSLKKFINKVQVVRWKIIKRWVRQILKALAYLHSQTPPIIHRDIKCENIFIN
GSTGDLRIGDLGLSTAKKVNEGKGQSVLGTPEFMAPELYDEEYDEKVDVFAFGMCVLEMI
TKQLPYSECTNATQIYRKVCGNVPPDALRLIPDDKALDFVKGCIQKDPAERLGAAELLKH
DFL
NT seq 729 nt NT seq  +upstreamnt  +downstreamnt
cgcaggtacgactccgtcgagggcatcgaggtcgcgtggaacgtcgtgaatttgaagacc
atgccccccaacgagaaggcgcgcgtcatcaacgaggtgcggctgctggaccgcctcgag
cacgagaacatcatcgacttccacgggagctgggtgaaccgcgagcgcggcgaggtctgc
ttcatcacggagatcctgagctccgggtcgctgaagaagttcatcaacaaggtgcaggtc
gtgcgctggaagatcatcaagcgctgggtgcgccagatcctgaaggccctggcctacctc
cacagccagacgccgcccatcatccaccgcgacatcaagtgcgagaacatcttcatcaac
gggtcgacgggcgacctccgcatcggcgatttggggttgtcgacggcgaagaaggtcaac
gagggcaagggccagtccgtgctcggcacgcccgagttcatggcgccggagctctacgac
gaggagtacgacgagaaggtcgacgtcttcgcgttcggcatgtgcgtcctcgagatgatc
acgaagcagctgccctactcggagtgcacgaacgcgacgcagatctaccgcaaggtctgc
ggcaacgtgccgccggacgcgctgcgcctcatccccgacgacaaggccctggactttgtg
aagggctgcatccagaaggacccggcggagcgtttgggcgccgcggagctcctcaagcac
gacttcctc

DBGET integrated database retrieval system