KEGG   Aureococcus anophagefferens: AURANDRAFT_35279Help
Entry
AURANDRAFT_35279  CDS       T04134                                 

Definition
(RefSeq) hypothetical protein
  KO
K01641  hydroxymethylglutaryl-CoA synthase [EC:2.3.3.10]
Organism
aaf  Aureococcus anophagefferens
Pathway
aaf00280  Valine, leucine and isoleucine degradation
aaf00650  Butanoate metabolism
aaf00900  Terpenoid backbone biosynthesis
aaf01100  Metabolic pathways
aaf01110  Biosynthesis of secondary metabolites
aaf01130  Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:aaf00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00650 Butanoate metabolism
    AURANDRAFT_35279
  09103 Lipid metabolism
   00072 Synthesis and degradation of ketone bodies
    AURANDRAFT_35279
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    AURANDRAFT_35279
  09109 Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    AURANDRAFT_35279
Enzymes [BR:aaf01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.3  Acyl groups converted into alkyl groups on transfer
    2.3.3.10  hydroxymethylglutaryl-CoA synthase
     AURANDRAFT_35279
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: HMG_CoA_synt_N
Motif
Other DBs
NCBI-GeneID: 20221582
NCBI-ProteinID: XP_009042899
JGI: Auran1_35279
UniProt: F0YBH3
Position
Unknown
AA seq 209 aa AA seqDB search
ADEAGIVALDYHAPSLCVRATDVERFHGSPGRYTVGRGQELVTFASDDEDAVSMALSALC
RLLARSELAFEDVGRLECGTESSVDRGKSTKSFLMSLFEATGDLDVQGADTVNACYGGTN
ALLSTRNWIHGPGWTGRYGAVVCSDPAVHPDPAQLAGVGASAVSLLAGPRASLAMETRCT
TFVKHAWDFYRPVGWSSNDALVDVAVATT
NT seq 630 nt NT seq  +upstreamnt  +downstreamnt
gcggacgaggcgggcatcgtcgccctggactaccacgcaccgagtctctgcgtccgtgcg
acggacgtggagcgcttccacggcagccccgggcgctacactgtgggccgaggccaggag
ctcgtcactttcgcgagcgacgacgaggacgcggtttcgatggcgctgtcggcgctttgt
cggctgctcgctcgaagcgagcttgctttcgaggacgtcggccgactcgagtgtggtacg
gagagcagcgtcgaccgtggtaagtccacaaagtccttcctcatgtctttgttcgaggcg
accggcgacctcgacgtccagggcgcggacaccgtgaacgcctgttacggcggtacgaac
gcgctcttgagcaccaggaactggattcacggcccgggatggactgggaggtacggcgcc
gtcgtctgctctgacccggccgtgcacccggacccggctcaattggccggcgtcggcgcg
tcggcggtgtccttgctcgcgggaccgcgcgcttctctggccatggagacgcggtgcacg
accttcgtcaagcatgcctgggacttttaccggcccgtcggatggtcgtccaacgacgcc
ctcgtagacgtcgccgtggctaccacctag

DBGET integrated database retrieval system