KEGG   Aureococcus anophagefferens: AURANDRAFT_3609Help
Entry
AURANDRAFT_3609   CDS       T04134                                 

Definition
(RefSeq) hypothetical protein
  KO
K01620  threonine aldolase [EC:4.1.2.48]
Organism
aaf  Aureococcus anophagefferens
Pathway
aaf00260  Glycine, serine and threonine metabolism
aaf01100  Metabolic pathways
aaf01110  Biosynthesis of secondary metabolites
aaf01130  Biosynthesis of antibiotics
aaf01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:aaf00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    AURANDRAFT_3609
Enzymes [BR:aaf01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.2  Aldehyde-lyases
    4.1.2.48  low-specificity L-threonine aldolase
     AURANDRAFT_3609
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Beta_elim_lyase Aminotran_1_2 DegT_DnrJ_EryC1
Motif
Other DBs
NCBI-GeneID: 20221687
NCBI-ProteinID: XP_009039500
JGI: Auran1_3609
UniProt: F0YGG1
Position
Unknown
AA seq 341 aa AA seqDB search
VDLRSDTVTQPTAAMRAAMGAAVCGDDVFGDDPTVAKLEARVGDLLGKEAAVFVPTGTMG
NLVSILAHCWERGSEYVVGDCAHVHIFEQGGASQFGGAHARAVPTAADGTIGDAAAVRAL
VRVDDQHFPATKVVALEDTHNLRGGAALPAGYGAAVAAAVRDLGVAAHLDGARVWHAAAR
RGEALAETAAPYDSLSVCLSKALGAPAGSVVAGSGDFVARCRRLRKGLGGTMRQTGVLAA
AGLVALDEVLPKLSEDAARATALAAGLGALGFDVEAPQTNLLYFGLDEARFGFSARALVD
HCADRGVRFLVVPGSTRMRMVCHHQITADGAERALAVIKAA
NT seq 1023 nt NT seq  +upstreamnt  +downstreamnt
gtcgacctgcggtccgacacggtgacgcagccgacggcggcgatgcgcgccgccatgggc
gccgcggtctgcggcgacgacgtcttcggcgacgacccgacggtcgcgaagctcgaggcg
cgcgtcggcgacctgctgggcaaggaggccgcggtcttcgtgcccaccggcaccatgggc
aacctcgtgtcgattttggcgcactgctgggagcgcgggtccgagtacgtcgtcggcgac
tgcgcccacgtgcacatcttcgagcagggcggcgcgtcccagttcggcggcgcccacgcg
cgcgccgtgccgacggcggccgacggcacgatcggcgacgcggccgcggtccgcgcgctc
gtccgcgtcgacgaccagcacttccccgcgacgaaggtcgtcgccctcgaggacacgcac
aacctgcggggcggcgcggcgctcccggcgggctacggcgcggcggtcgcggccgcggtg
cgggacctcggcgtcgccgcgcacctcgacggcgcgcgcgtctggcacgcggcggcgcgc
cgcggcgaggcgctcgcggagacggcggcgccctacgactcgctgtccgtgtgcctctcc
aaggccctcggcgcgcccgcggggtccgtcgtcgccggctccggggacttcgtcgcgcgg
tgccgccggctccgcaagggcctggggggcacgatgcgccagaccggcgtgctcgccgcc
gcggggctcgtggcgctcgacgaggtcctcccgaagctctcggaggacgcggcgcgagcg
acggcgctcgccgcgggcctcggcgcgctcggcttcgacgtcgaggcgccgcagacgaac
ctcctctacttcggcctcgacgaggcgcgcttcggcttctccgcgcgggcgctcgtcgac
cactgcgcggaccgcggcgtccgcttcctcgtcgtgcccggctcgacgcgcatgcgcatg
gtctgccaccaccagatcaccgcggacggcgccgagcgcgcgctcgccgtcatcaaggcc
gcc

DBGET integrated database retrieval system