KEGG   Aureococcus anophagefferens: AURANDRAFT_59212
Entry
AURANDRAFT_59212  CDS       T04134                                 

Definition
(RefSeq) hypothetical protein
  KO
K00222  Delta14-sterol reductase [EC:1.3.1.70]
Organism
aaf  Aureococcus anophagefferens
Pathway
aaf00100  Steroid biosynthesis
aaf01100  Metabolic pathways
aaf01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:aaf00001]
 09100 Metabolism
  09103 Lipid metabolism
   00100 Steroid biosynthesis
    AURANDRAFT_59212
Enzymes [BR:aaf01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.1  With NAD+ or NADP+ as acceptor
    1.3.1.70  Delta14-sterol reductase
     AURANDRAFT_59212
SSDB
Motif
Pfam: ERG4_ERG24 DUF1295
Other DBs
NCBI-GeneID: 20222752
NCBI-ProteinID: XP_009038891
JGI: Auran1_59212
UniProt: F0YET8
Position
Unknown
AA seq 236 aa
MGRELNPRIGSFDLKCFCELRPGLIGWAVLNAGMLCKQRELDGKVSGAMVLVNAFQLLYV
WDALFYEKVILTTMDITTDGFGYMLAFGDLAWARYLVRHDPGLGPVALAAIVALKVVGYA
VFRGANNQKDAFRRDPAKAIAEGTTFLDTRRGTKLITSGYWGAARKVNYTGDWLMSLAWC
LLAGFGSPVPYFYCAYFLVLLVHRALRDDHACALKYGADWPEYKKKVPYLFVPFVF
NT seq 711 nt   +upstreamnt  +downstreamnt
atgggccgcgagctcaacccgcggatcgggtccttcgacctcaagtgcttctgcgagctc
cggccgggcctcatcggctgggccgtgctcaacgcgggcatgctctgcaagcagcgcgag
ctcgacggcaaagtctccggcgcgatggtcctcgtgaacgcgttccagctgctctacgtc
tgggacgcgctcttctacgagaaggtcatcctgacgaccatggacatcacgacggacggc
ttcggctacatgctggccttcggggacctggcctgggcgcggtacctcgtgcgccacgac
ccggggctcgggccggtcgcgctcgcggcgatcgtcgcgctcaaggtcgtcggctacgcc
gtcttccgcggcgcgaacaaccagaaggacgccttccgccgcgacccggcgaaggccatc
gccgagggcacgacgttcctcgacacgcggcgcggcacgaagctcatcacgtccggctac
tggggcgccgcgcgcaaggtcaactacacgggcgactggctcatgtccctggcctggtgc
ctcctcgcgggcttcggctcgcccgtgccctacttctactgcgcctacttcctcgtcctg
ctcgtgcaccgcgcgctccgcgacgaccacgcgtgcgcgctcaagtacggcgcggactgg
cccgagtacaagaagaaggtgccctacctcttcgtccccttcgtcttctag

DBGET integrated database retrieval system