KEGG   Aureococcus anophagefferens: AURANDRAFT_63865Help
Entry
AURANDRAFT_63865  CDS       T04134                                 

Definition
(RefSeq) hypothetical protein
  KO
K00232  acyl-CoA oxidase [EC:1.3.3.6]
Organism
aaf  Aureococcus anophagefferens
Pathway
aaf00071  Fatty acid degradation
aaf00410  beta-Alanine metabolism
aaf00592  alpha-Linolenic acid metabolism
aaf00640  Propanoate metabolism
aaf01040  Biosynthesis of unsaturated fatty acids
aaf01100  Metabolic pathways
aaf01110  Biosynthesis of secondary metabolites
aaf01200  Carbon metabolism
aaf01212  Fatty acid metabolism
aaf04146  Peroxisome
Module
aaf_M00087  beta-Oxidation
Brite
KEGG Orthology (KO) [BR:aaf00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00640 Propanoate metabolism
    AURANDRAFT_63865
  09103 Lipid metabolism
   00071 Fatty acid degradation
    AURANDRAFT_63865
   00592 alpha-Linolenic acid metabolism
    AURANDRAFT_63865
   01040 Biosynthesis of unsaturated fatty acids
    AURANDRAFT_63865
  09106 Metabolism of other amino acids
   00410 beta-Alanine metabolism
    AURANDRAFT_63865
 09140 Cellular Processes
  09141 Transport and catabolism
   04146 Peroxisome
    AURANDRAFT_63865
Enzymes [BR:aaf01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.3  With oxygen as acceptor
    1.3.3.6  acyl-CoA oxidase
     AURANDRAFT_63865
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Acyl-CoA_dh_M
Motif
Other DBs
NCBI-GeneID: 20224542
NCBI-ProteinID: XP_009036542
JGI: Auran1_63865
UniProt: F0Y831
Position
Unknown
AA seq 1152 aa AA seqDB search
MRPRAITSASRAEYDYVAPQTQVIATGAATPLTCAARPAPPFLGDSPAIVAAAVAAAAPP
PSPVVVRPPPRPRSAPAPPLAPPRDVAQRVAALAGQAAALDALAARLDALSGRKEAPVGA
SVGSAARELVDSVARSPVRGTAPLEASLEDLAAAADSADAATFGSMCETLIDVDGLLRRA
DGVDDPGLTAVDVPAWARGDDAGCRDRLLAERAVHLRQIRALLAVNGRLEAELESLRASR
APDEAPAADDAPPTARVLDAAFREEGGSVRGSVRGSDGGSDGGSDGGASEDDDGGGLRAR
VAVLEDALEDTTAQLGAVAEVAKDARAALDAASERLARSEKARAELSARLVDEAGDWEAD
VARAERDEARRCAAEAEAMAREELDQWRRASGVAARSAPASVVGVSRTPPRRALEDAATS
PVDCATSETASDAATATSPENAASFDAATATSPRRSSEAATATSPRRSSEAATATSPRRS
SEAATATSPRRSFKAVATAATATSPRRSFAVGTQSAADVASAATATSPKRSFAVATQSAA
DVAAAESQWSPRGDFLAAAACQWSDDDDDGEGPAGRSALADAAPEAAAEALGDATGRHLA
RALGGRGDCGADALATKRSALLLKRPRGTAHQRHSRVLHNLQVAGAQAVDARAALAELLP
EGARSLRAAVITRAPAPFSTAAVAPRDEEAEWEAAFLEATDVVSGDSDHTESSEALRALV
KSGLLKHTDLRDRPDRFFKAHRLLARHAVREGPGFWIRFTVHYNLCFGTVLAVGGPEQVA
AMADVEAQGQLGCFALTERLAGVQSGLVVETTATYDKESKEFVLHSPSEGSLKNWISQGH
VADKAVVLADTTVDDQRVGPHAFLMDLASPGVSTGDMGVKTTGNDLDNAWIAFDNVRVPR
TALLNGHCDVDEATGGYVLKTQGVKPFEMIGQRLYTGRVAVAQAALAFRSQLFDVTKAYA
DNKSIPDVARTGAAPKLSGIPQLKALFAEADETAALLEDFVNKCEDRLAPLLRTGAVPDE
ELAHAIATAKVKAVEHSIDLAWRLKQEVGSYALMGSSGFKHLDFLNCCKFAEGDSRILMQ
KMARDRLRKFAADLKAGAADDGTEEARLAGELAAALAPARGDKAQQAALWDEHYLLVYAL
AEQMMDRTIREF
NT seq 3459 nt NT seq  +upstreamnt  +downstreamnt
atgaggccccgcgccatcacctccgcgagtcgcgcggagtacgactacgtggcgccgcag
acgcaggtcatcgccactggcgcggcgacgccgctgacctgcgcggcgcggccggcgccg
ccgttcctcggcgactcgccggccatcgtcgcggcggccgtggccgccgcggcgccgccg
ccgtcgcccgtcgtcgtccggccgccgccgaggccgcggtcggcgccggcgccgccgctg
gcgccgccgcgggacgtcgcgcagcgcgtcgcggcgctcgcgggccaggccgcggcgctc
gacgcgctggcggcgcggctcgacgcgctcagcggccgcaaggaggcgcccgtcggcgcg
agcgtcgggtccgcggcgcgggagctcgtggactccgtcgcgcggtcgcccgtgcgcggc
acggcgcccctcgaggcgtcgctggaggacctggccgcggccgcggactccgcggacgcg
gcgacgttcgggtccatgtgcgagacgctcatcgacgtcgacggcctcctgcggcgcgcc
gacggcgtcgacgacccgggcctgacggccgtcgacgtgcccgcctgggcccggggcgac
gacgcgggctgccgcgaccgcctgctcgcggagcgcgccgtgcacctgcggcagattcgg
gcgctcctcgccgtcaacggccgcctcgaggccgagctcgagagtctccgggcgtcgcgc
gcgccggacgaggctccggcggcggacgacgcgccgccgacggcgcgcgtcttggacgcc
gcgttccgcgaggagggcggctcggtccgcggctcggtccgcggctccgacggcggctcc
gacggcggctcggacggcggcgcgtcggaggacgacgacgggggcggcctccgcgcgcgc
gtcgccgtgctcgaggacgccctcgaggacacgacggcccagctcggcgccgtcgccgag
gtcgccaaggacgcgcgggccgcgctcgacgccgcgagcgagcggctcgcgcgatccgag
aaggcgcgcgcggagctgtccgcgcggctcgtcgacgaggccggcgactgggaggcggac
gtcgcgcgcgcggagcgcgacgaggcccggcgctgcgccgccgaggccgaggccatggcg
cgcgaggagctggaccagtggcggcgcgcctcgggcgtcgccgcgcggtccgcgccggcg
agcgtcgtcggcgtgtcgcggacgccgccgcgccgcgccctcgaggacgcggcgacgagc
cccgtggactgcgcgacgagcgagaccgcgtccgacgcggcgacggcgacgagccccgaa
aacgccgcgtctttcgacgcggcgacggcgacgagcccgcggcggagctccgaagcggcg
acggcgacgagcccgcggcggagctccgaagcggcgacggcgacgagcccgcggcggagc
tccgaagcggcgacggcgacgagcccccggcggagcttcaaggccgtcgcgacggcggcg
acggcgacgagcccgcggcggagcttcgccgtgggcacccagtcggcggcggacgtcgcc
agcgccgcgacggcgacgagcccgaagcggagcttcgccgtggcgacgcagtcggccgcg
gacgtcgcggcggcagagagccagtggagcccccgcggcgactttttggccgcggccgcc
tgccagtggagcgacgacgacgacgacggcgaggggcccgccgggcggtcggccctcgcg
gacgcggcgccggaggccgcggcggaggcgctcggcgacgcgacgggccgccacctcgcg
cgcgcgctgggcggccgcggcgactgcggcgccgacgcgctcgcgacgaagcgcagcgcg
ctgctgctgaagcggccccggggcacggcgcaccagcgccacagccgcgtgctccacaac
ctgcaggtcgcgggcgcgcaggccgtcgacgcgcgcgcggccctcgcggagctgctgccc
gagggggcccggagcctgcgcgccgccgttatcacccgcgccccggcgcccttctccacc
gccgccgtcgccccgcgcgacgaggaggcggagtgggaggccgccttcctcgaagccacg
gacgtcgtcagcggcgacagcgaccacacggagtcgagcgaggccctgcgcgcgctcgtc
aagagcggcctcctcaagcacacggacctgcgggaccggccggaccgcttcttcaaggcc
caccggctcctcgcgcgccacgcggtccgcgagggccccgggttctggatccgcttcacg
gtgcactacaacctctgcttcggcaccgtgctcgcggtcggcgggccggagcaggtcgcg
gccatggccgacgtcgaggctcagggccagctcggctgcttcgcgctgacggagcgcctc
gcgggcgtgcagtccgggttggtggtggaaacgacagcgacgtacgacaaggagtcgaag
gagttcgtgctccactcgccgagcgaggggtccctcaagaactggatctcccagggccac
gtcgcggacaaggccgtcgtcctcgcggacacgaccgtcgacgaccagcgcgtcggcccg
cacgcgttcttgatggatttggcgtcgccgggcgtgtcgacgggcgacatgggcgtcaag
acgacgggcaacgacctcgacaacgcctggatcgccttcgacaacgtgcgcgtgccgcgg
accgcgctgctcaacggccactgcgacgtcgacgaggccacgggcggctacgtgctcaag
acgcagggcgtcaagcccttcgagatgatcggccagcggctgtacacgggccgcgtcgcc
gtcgcccaggccgcgctcgcgttccggtcccagctcttcgacgtgaccaaggcctacgcg
gacaacaagtcgatccccgacgtcgcgcggacgggcgcggcgccgaagctctcgggcatc
ccccagctcaaggcgctcttcgccgaggccgacgagaccgcggcgctcctcgaggacttc
gtgaacaagtgcgaggaccggctcgcgcccctgctgcgcacgggcgccgtgcccgacgag
gagttggcgcacgccatcgcgacggccaaggtcaaggccgtcgagcactccatcgacctg
gcctggcgcctcaagcaggaggtcggctcctacgccctcatgggctcgtcgggcttcaag
cacctcgacttcctcaactgctgcaagttcgccgagggcgactcgcgcatcctcatgcag
aagatggcgcgcgaccgcctccgcaagttcgcggcggacctcaaggcgggcgccgcggac
gacggcaccgaggaggcgaggctcgccggcgagctcgcggcggccctcgcgccggcccgg
ggcgacaaggcgcagcaggccgcgctctgggacgagcactacctcctcgtctacgccctc
gcggagcagatgatggaccgcacgatccgcgagttctag

DBGET integrated database retrieval system