KEGG   Aureococcus anophagefferens: AURANDRAFT_6781Help
Entry
AURANDRAFT_6781   CDS       T04134                                 

Definition
(RefSeq) hypothetical protein
  KO
K03773  FKBP-type peptidyl-prolyl cis-trans isomerase FklB [EC:5.2.1.8]
Organism
aaf  Aureococcus anophagefferens
Brite
KEGG Orthology (KO) [BR:aaf00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03110 Chaperones and folding catalysts [BR:aaf03110]
    AURANDRAFT_6781
Enzymes [BR:aaf01000]
 5. Isomerases
  5.2  cis-trans-Isomerases
   5.2.1  cis-trans Isomerases (only sub-subclass identified to date)
    5.2.1.8  peptidylprolyl isomerase
     AURANDRAFT_6781
Chaperones and folding catalysts [BR:aaf03110]
 Protein folding catalysts
  Peptidyl prolyl isomerase
   FKBP
    AURANDRAFT_6781
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: FKBP_C
Motif
Other DBs
NCBI-GeneID: 20226445
NCBI-ProteinID: XP_009039102
JGI: Auran1_6781
UniProt: F0YF84
Position
Unknown
AA seq 121 aa AA seqDB search
FLAAYARGAGTVARPSGLLYRVKRYGFGGSPALDAACDVAYDGKLSGDWPDGPSFDGTRL
KRRPSTFAASKVIGCWREAMPLMTVGSVWELACPPDLGYGPRPVRDRIPGGSVLVFELEL
L
NT seq 363 nt NT seq  +upstreamnt  +downstreamnt
ttcctcgcggcctacgcgcgcggcgccgggaccgtcgcgcggccgtcgggcctgctctac
cgcgtcaagcgctacggcttcggcggctcgccggcgctcgacgcggcgtgcgacgtggcc
tacgacggcaaattgagcggcgactggccggacggcccgagcttcgacggcacgcgcctg
aagcggcggccgtcgacgttcgcggcgtcgaaggtcatcgggtgctggcgcgaggcgatg
ccgctcatgaccgtcgggtccgtctgggagctcgcgtgcccgcccgacctgggctacggc
ccgcggcccgtgcgggacaggatccccggcggctccgtcctcgtcttcgagctcgagctc
ctg

DBGET integrated database retrieval system