KEGG   Aureococcus anophagefferens: AURANDRAFT_72083Help
Entry
AURANDRAFT_72083  CDS       T04134                                 

Definition
(RefSeq) hypothetical protein
  KO
K12567  titin [EC:2.7.11.1]
Organism
aaf  Aureococcus anophagefferens
Brite
KEGG Orthology (KO) [BR:aaf00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:aaf01001]
    AURANDRAFT_72083
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:aaf04131]
    AURANDRAFT_72083
  09183 Protein families: signaling and cellular processes
   04812 Cytoskeleton proteins [BR:aaf04812]
    AURANDRAFT_72083
   04147 Exosome [BR:aaf04147]
    AURANDRAFT_72083
Enzymes [BR:aaf01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     AURANDRAFT_72083
Protein kinases [BR:aaf01001]
 Serine/threonine kinases: CAMK group
  MLCK family
   AURANDRAFT_72083
Membrane trafficking [BR:aaf04131]
 Others
  Actin-binding proteins
   Others
    AURANDRAFT_72083
Cytoskeleton proteins [BR:aaf04812]
 Eukaryotic cytoskeleton proteins
  Actin filaments / Microfilaments
   Actin-binding proteins
    Others
     AURANDRAFT_72083
Exosome [BR:aaf04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   AURANDRAFT_72083
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: fn3 PA14 Pur_ac_phosph_N Filamin DUF3823_C SusE
Motif
Other DBs
NCBI-GeneID: 20228540
NCBI-ProteinID: XP_009039296
JGI: Auran1_72083
UniProt: F0YFV5
Position
Unknown
AA seq 15048 aa AA seqDB search
MASFGSAVGSPLKFLVALAATVLPGAADLQVPSAPTDALLEVVSGDSLALAWASPMTDGG
AAVQSYQVEWDTNPGRAEVQTVTTSTYIGANELQTISTSAADIDEIQNVTTVASPIREVQ
TVTATAPVGGTLAGTFALALDTRVTGGSLQYTGAIPADAATCCGRTSMTAMVEALSNVGS
GNVYNVSREAVDVDGGVGWRWRVTFDRSLADVPQLQLLDASALTLGSSIALGTAVEGNAI
SGAFRLSFNGDTTALIPSDATAGELEDALELLDTITDVTVIRGDEAAFGGFTWWVTFVHD
DNAGDVPLLEPVWSGTLLGTSGDPWVNVTEHVPGNELSGSFNISFNGNAESAKVPFDATV
SELANALQSLPQIPDGTVAVTRTGPDFELGYVWTVSFLDDVNRTFEGDVSPLTVSSSTYL
GGQNAQVDVAELRKGTVKEIQRLNVTRTSNKDDAFYLTFRGETTGAIYASPDKLDKSCGS
AEYEVQQVRVATQDTTSAGGDGTVSPRTTFRLSYGSETTDYIYANDGTGDCSVAAGEIET
ELEKFDAFYQVDVSSSVRNSRLQRLRSRSYSATVAAQECWWNVTFSSSPGNVAALTVSAS
REGVGAEDGPASSASIGDDTLYVRELVSGKTDLVQSELEGLSTIGRVTVDSRPDPINALT
CLYTITFDTNAGYLPLIGVATSGTDETGEWPWADTNTTVNVTRIRSSTSEALSGDFALEF
RGQRTGYLTYDSSSYDVEAALESLSTIGSVAVNRTAADENGGHTWSITFLSELGDVPMLI
ADDLDMSGTAVTATTYLVTQGVFPPFNSLDEANGLPLGSAAVTDLADLQLEVSGLERNIP
YYFRVFAVNAIGQGPASLTTPPYAIPVPAKPSEPTDVALSVLDSTSLRVVLADPLRDGGD
SVDSYRVEYAGEAFTDEVQAVRIYVNSTTEVQVIETNVTEKPEIQLVHALLDPSYAGATT
VEWQLLECDASGGSFTLTFDGLTTRSIAYDADEATVKSALQELTNVNKVTVAFVGVGLLS
DGVVDTACVDGGDSRVDYADSATGFTAGMNITFNSVSDYVGDVPALEPYTNELDGLRRVV
VTEFDGDWGLGGTFKLTFRGATTDAIVYDASASAVESALIALDTIQQGGVEVSDVSASMS
TPYDSNEHLWEVTFVGSGVGGDVEALQIRADDDLLTGSGARLRVYADGSEKSSDIRSSAT
AESRAGSELGGSFTLTLRQHTTEPIEFNAAASTMKARLEALPNVGNVDVLRSAPGSRREY
AWTVSFVSNPGYFPPNSRNLALLVPDTSDLEGTGASCEVKERLQGSEPLKGAFQLMFCNS
TYADGYADACEYTDLLENDLEAPQFEAILEDLDHVGDVDVSRVTNSDGYTWYITFGGCSL
TEDLEDVCNEGDVALMKWLESNSTLTGGSSAPNVTIEEVVRGTGPGTCSDRVDEDGKCVA
VETDLSGGEPYAYDILGLETGERVYVRARWHNELGFGPYSLSEPEWNAPGAPPAVRLLNS
SAVSVAVAWDRPTEDGGAPVMGYELWLDNWEGGASRIVFDGSDQPDTMAFTVRTKTSVGV
ESGKQYRFLVRAVNYCSSRDTDLLCYGEFSPVSVFTNDGEAEVAVVSGGATPAAPVRTTD
PRVVVKLRLGCGNWGMGVPDDPSEGEAVRGARRARDLDLGDEPRSKPAALGAADRRLIAK
LRPGCEGWGMGVPYDPSKASEDETSAPRPRDGNGDVVMDDAGDSGDAGDSGVGANGFRDV
FMGDAGDAGVGANGFGDEDFGGGFDADDEREGDGHGHGDGHGRAPAAPSPLPHERRYAAA
AALERSSGSGRGGEAQAAPPPAGLGRVGGAGTRLWFAVPADGELDEPGAPVVVALPGMGK
VKVLVPPGAREGDWVAFAGNVVLSRRTGAAPCGASAARPVAVGSFEFHSSGPAELVLESL
GGAAAAGPPSDQAATRVVGSRVGGVVAFAVPASHEVGAPLLVEAPGTPAFRLRVPAGVVE
GDALLLEGKLALTSAGKGCDVAWAVPRDGGFGGFGGFEDPGSGGFADPGSGDDSIGGDGD
AIWATDRLAELGLALKLHDVALRQMFDMNADEADTRGFVETVVPAGDAREKFLQSLFERR
RQRRAVRRAAAAELRRPEAASASLPATPVGVASLLPARDGDPPELVIDLFPAWDADMEYV
PRGRDLGLADRGVDLSGEPGDSSGSKASPGAALQVATLDGGSGGEGDFGEDLGFADRGGG
YGRGGSGRGDVGADPGGLSGGFGGGSGGGTPGLVGGEAPRAAGHPPESSPGADLSRGSGF
GGGVDAMDLSGDSSGSETYLSGAGGFGGGGPGLHERGGTSVFSRTRSRRKPAADRRRRGP
AMASADGPSLGPDLGGLSDGSGGGPGHRAGARALDEAVDDALDGTVASRTRLGEGRLRRC
DNYVESDGDGSSGEEFFVDKRTRGDDDGSEPDDEASGILADRGGRGRGVSGFGSGASFAS
GLKGKSVTSAASVELDEGSGDSRDGDEDGGGEEGSLDLSQAVTRPYFVYHAGLSQHSELG
AKQANDAKVFVHVDKNPLRREDLLDDLFRSSYLDSRVLNEFCRAANAPMSNIPKVAVKAL
VKHFDDNPGSVIVSTLNVETKLKHYAMEMKERAADREKAEKAEAEEKAAREQERDVRHRS
EVDIVACARAGVPFKSIAAELGTGAEALTPGDVADIVRRLAPEFDGVKGSLGVFGSARAL
EPTDQEMSLNSEDLAHAELAQAPQAAGCGVKATPGSAAITEAQRVRVSYNATHVFLRKLV
KKLRAPGGGLKPSIRKKAARDDKAGVGVRMQILAFLEIAIGIRRTFLVQSDPDDPLISGP
NGRTTAAVDVPTEELLDDLEVLFESYWKLWMAPPSKEFSKIVLDADIPSVDKLPGRSVVM
RHVVDQLSEGELYRFYVGETSVHVGWRAPAPNSTGGSAITGYNLYMLNSVSDPDPVTVER
ILSGSSELTGTFTLSFDGAETEAIDVDASAEDVKAYLEDLSTLSVVEVSRNTTSSWGAAE
WLVTFLSEAGDLPLMRATSGRLSYDSATPAAYVETVLPGTSAVLVYNGSNQGRTRERNSQ
LQRLLSRPFSTRSDAPDVLDFEATGLTTDSLYAFKAGVVYEQQVVSLDLSGGDAFLRLGN
GYEWYTITFLDRVGDVPLLELSASDAGGAPLRDLTAARKREGEDIFYTELFEYDEDGEYV
HYADGGVATYNPAQYEIQKLVFDAGYSGDYTISLNQSSRADGVNDKTAALSSGCTAYQMK
VALEALDNIEAVDVSRNGSSATGLSSTDTEFVEDTQSIHVKTSTDGYFTLRLGDGTDYTT
SLDLTSATNAEVEAALEALDGVYDVSVSDGTADAGSFTGNAWDVTFHSPVGDVSNLVVLD
SSGDDDGDVTYNVVELVKGDSGLAGTYTVAYEGSYSADIAYEATAADVDVEKEVLGSSIK
LGNLRELAASPYVYEEQTISTTGGDPTPLGGSFSLTFYNETTGPIAYDASADAVKAALEG
LPSIDRVDVAKVEGSYGQADWLVTFRSELGDLDLLDCDASLTTGSDAACAADEIVAGDSD
SLTGNTPTVHTEEKVAGLPSYTGMFTPAATGDYDVVVRQLTQGGLSAEYFDNQWLQGDPT
VERIDAAINFDWGTGALTPYGRDYVSARWSGKLKASYNEIYTIFCRADDGIRLYVDHELV
VDAWENASVTNGGQRVDLRLSAGGYHDIVVEYKERERERHNSHTKRAARDASHTALILGT
YRLAFAGGKTLELPLNATAAALESALEKAHDDAVDVSVSRQDFAAGFGADHEYTITFLSD
LDAWASDSLKVLSPEDGNGAAVAEVNISRPAAGGHYPVDFILGYVGEYELSVTSSGRHVE
GSPFEVDCEHGVATSGATTVASDNINEAVAGDTIVLDVHARDHRQHEVQIVAVAAQAVDT
VPEVQRVHVGSSAFTLTFRGATTSSFALGGTEATLEGLIEDLPTITGGVTVTEETSSDGT
IDASDTFLVEFSGVYGDVPLLSTTATKVHEVTKGDAPYVREIQTFYCDATSGNLAVDFRD
YDTTASLDVSTATVADLATELAAVGIAVSAWRHDDKTDSALTICGSGNTVAEMVYVEFLE
LTGDLPALEYNASSTALASSIVAYSGGNYGQVDGVHPVWGTFTLEFGGWTSDPIRADASA
DELRDSLEALPSIGDVSVYKTTIGQCLDQLDRQIFPNASRLSVWEVHFDGRCAISGWDFC
PDTLGDVAMLAADASGLAYDLSPYERQAAPTVRVTEAIKGTTGNLVTSSGGDEIIEYSAT
HQQHTDVGIDMYETQRLRCATQSGGNFSLSMLNNATGLWETTTNVTGLTNIANLKAALLA
LPGVKPGLTVTGGNANGDICCTDATASTCAWVSVAFVGNFGTLPMLEFGEEQGVDLEIEE
IVKGIDSLEYAGDGLYRLAVTPTVSGNYTFTLRISPQFFGGANATTDVSTELSAGLIVLP
AQASGPQSHHYADLRATTAVESTFLVQARDRFGNRLGRSLDAGPGSHFAVDLNGTGFEGG
GREGDRSLVAGAVDDKYVPNTDGLYEASYTPELAGPHVLEVELTQPGGLLATYYAQMDFV
DPALHATGWRAWPYHEPKWCPPEALTPCDSTRLDGPLDLDFGGLAPLSQTEWPDFPADFF
SARWVGHLLGPVDGVVTLHLRTTEAVSLVLDGETLIDTMDASGSLVDVASANFTATKNEL
YALEISFVEEIDGAAISFEWTVGGAQAVVPASALYYTRHAKLSPETVVVYPDRIAAATTA
AEGDGTLACVALEECSFVVTATDADGNYRVNTGADELVVEILGVGDWAGEGRTNEYDSYG
VIEVDQVTDVNVAWDYVGTASVYNNVSKLYNLSGAFETLLRGDVLSIGDGDLQDASPEFI
AIGSGAFYLNDTVGADERSVPLADVWRGNDAHRVRVYKGAYAGDTARHTISYTPYVRGTY
DLDVRVKKTEEVQQVVVSVGAGLCAGKKLAGNFTLSLTAPDKFGVVATETTPPIAYDATP
QDVEDALITLSQVWACNVSGYNSAPKNGSKFRVEFSGVYPLVGADFPLLVPDTTDLTGNR
AAVDVYEVVKGVPEASIAGAPFPLVVSPNDASSAWSTAYGRGLVQGVAGETSSFTIIAKD
EWGNTRFDAQDESKFSVLAFVEMTTPGADGWSRKNSDGLVASTATAVNGSVAYVGDGEYV
VSYTPVASGPTTVAVVLQDAVEEQVVSWNATAPDDAVKDGGGVVFSIAGSASDEVAWDSE
ASDVAAALSALGWGAVEVSRGIARGTDDLSKYDAAALRGLQIDSVNYVYSVTFSDYVGDV
PPIEAHFPLDANFIDYASASVAEVVKGSWGVVKASESKITATPWVNEALVREKQVVRLVG
SGSYDGNFTLEFKDAETGMIPVNASAAQMKQALEVLETVGEVDVTRFGELGAGALGYEWV
VTFGKGRGTETDMTNLGDQPALIARNSTLTGGKITVYASGATSPGGKASRDGVAPFQAAV
RPAAVSAPNCTAVDAAGVAGRDGLTTGFFERESGFVIEARDAFGNLNPYGPRAETQIVDV
FGNASDAVNHTGSAFSISFLGETVAIPYGAGIADVEVAIEGLPDVGAVSVSTTSAHDIIS
GCVANATFGLSVIDPSCDLSAYFEVGDWIRVGRNMSTTQVFTVVHMQAVSPYALTLSSQW
LGDDDGELKIYEHGAGLKGHRAAYRYVVTFDTLLGDLPTMAATPSSIKFTTAVTYCERYR
YQTIKTSDNNANATAGDMINGTFMLEYRGASTRQLPHDVTMSALETALEDDLPGVYSASV
LERHGPFARNEYKWLVRLDSVVDDAPELLYAEGYLLSGGDAAVVADDDTCPAASESAAGA
RVYSQAGRLGAQFVARLSGPEAVNANVSYRSHGFYDATYGTPVVGSYLVDVSATESGGLV
GTYFNNRWLYGDSVLTRVDHSIDFEFDEEDAITETGKDHVSVRWTGFLRPSFDERFTFHA
QVNDGARLFVDGELLFDAFENEVEDAAGYAEFSGTTSAPLLAGALVDVTMEWRETTGNAV
ARLLWSSDSQPYGLVPSSRLFHHASDAVISSPFVYAPEAVKASTPLDVELSRNEWDEIVV
TWDAPANDGGEPIADYKVEWWSAVDGDYGVPEVQTLRVPKGSDRGTFYLYSPGGFRYPWA
LPYDVAAQDLEEALEFCYDVGDVSVKQPYATDDGYVQYEISFDTNVGNFGPISVDAAGFV
PEVCHSKYRLGRGCLNVTNGTAAILGSSTDASLDVEPGARYAYTIDTLWQKSGTLDGFGV
RVSAGNSAGHGIPSDALYLKPFAPADAPEEVQVERVPDEEAQLKVQWLTPRWPYDRQSLV
TAFVVEYSETEDFAESVSTTLSKAACASPRLLFDSAVGEAGVWMQHTLDDLEPGTYYYVR
VAAVNDAGVGAFGVAATTAAAIADKLTDGAVGLATLAHDGGVSVSDAATSLSVSWAPPAS
DNGYDVTAYGVEWWRGSGVDEVEVVQIDAVALNVTGTFTLSYEGAVTGHLPCDVSAADME
DALEALDTLRDVHVERAVDGGANFSWTVTFLTEWPDATDSRLVIDDAGLYSVNSTVRARV
GYGLRPDLPGHRFTLSNVTVRSGSAVVRAGGTWNSGSRSQESDRVHAYDWMDIDGGIYQV
ASVNAQANKITLTEVFSTGPSGAYSAQVGVTVPGSPPPHYDYVEVAPSLLSSSGRYSYVI
PDLVSGEAYTVRVSSITALGAAQPRYTQPRSLAPPRQVPDVPINTHLLVYGGTSLRVLFN
HPASDGGSSVTRYRIEWDTSSEFDSFDGSPLGSNTVLVDPTSGSYDDCTLSYCGYTIGSL
STGKNYTARVFAANAYGYSTTSAIPEPLFEAPKKPPSPPETLGLFAVSRTSLQVAFGDSA
DEGGADVTHAKLEWDGVGPAAAAAGGSSSLYSHNEVQRITTASKYRDLEGTFRVAFRGHT
TGQLDHDCTSDDMAAALEALAPVGDVTVTREEVGYGLAWYVTFEAAAGDDDWLGDLPQLT
VSAVDDDLASNFSTYESLVSASLTGGDTLTTMTGTDASIAADTLVDRYDGFCIQTVYTYA
QNATLLGTFALKYDSEDGVVATQYLEAGATAASVKAALEAIGTGELFVGATQAAMGKEYT
IVFLERLGPVPPLTFDASRLYGGQNRYATTGITVAVTVAGRLPAMDSPLRGEAEVELDTL
DVDSLGRYVYELEDLVAGEPYSVSVSLYNGVRSTYGLATHSTPASLVPAAPPGPPRSVSA
VALSDGSLNVSWTPPVDAGGAAVTKYRVEYDSTAATHEVQRVEFECADGPLVGSFTLTFN
GVATGPVPAGASADRVRSALEALATVGEVSVSLASSDDSASYQIAFRTNVGDLPALEAST
TALRGSDGGPASSAVYEQVKGGSPPFDEGTVGIYTLPLGSVDVVPVAEVQVVEVGAKAED
VNGYFYLSYGAAVSDAIPADATAAEMAAALDELKTLGPVTVSRATKTHRTTEPLQDPSYV
WSVTFDAALGDVPSLLVYAGTGLTQEVIGAHGHLEGSAPFGNVSELVKGGLPEWIAAGGG
DLVAGRPYYARVAAYTATTTAWSEPQLATLTAAPEYAVPSPPVDVKVSVAGPESLALSWA
PPAATGGAAVSHYLIQYDLDTSFDESTGASRVPLSELAWDDNAGRWAYVLDGLTTGTTYY
CRVMSYNHAGYSDPEMAASRNDAPLYRVETTQAFRLKVEARERVDSTPTIAAGSTADAVA
QAIMDLPDVATGAILVRRWDMSSWTDSTGMGTHWSGTKYAYEIEFGNDRDAVLALTGVDD
EVQASNVTQFVTPAGDAYGIAPAYREPSAPTAVLLSSVSRSNLGVSWSAPDLTGGSEVLK
YLVEWDSDRDFSTLRDMDSSFGSVAAATAGAVVVNATKSEAESRRSEFQYQITGLVMGRS
YWVRVSAYNDYMGYGDAASSEPASAAPADQLLGAPSKFRANLSDTEMPDRLLLTFQQPVL
DGNGFDIGTGADYTPNKATAYRIEWSASSSFPAAETSYYDWRALEDDDQDLECEGDCTID
LGAEVQSVRVFSDSDSPLTNGSYKLIYAGPSSPTTRLIVTPGSARAEYVNVSKDVDSATV
ANAADVIRTGDFVRLGGVDGKLYYVNQTTSGNCTLHEPYSTGLGSYVDSHTAAAEIEAFV
VTPPETCIPYDATPAEMLDHLREQMDDLPFEETLVVSRDSNTSVDSGYRYRVTFSGGAFS
AQPVAELEVVSRLTAATHGLADICANFTKAQSIGSNVSVRTIQVVHSVTTDIDSDALAPG
APYYLRLAAVNDVGVGSYAAPSIDGKHDTLGAIAPSAPPGLPTNVKVFAEKESATSLLVT
WETVDDDHGAEITGWRVEYANASYSETYDNDWHKGFFFKEADADARSFLLDNLTAGTTYA
VGVRAVNARGPAPPAWYEYTRPSLPWWYEQTDLFDVKEGRQRAVATCPPTGLTECVEEPD
YFILARATPDVPLTFLAQNGPEGFAGPDGFTAMSVVTSWKNGGNRGDEVDKFLVEWSMDD
QFAGDSYQSKIVQNNRTSEPNVEQVLNLTCADDDCRGDIVFVRISAHNSLGFSNVSETME
AVPMKSSDAPYAPSLEALDEDAGEYTVQDVGSQLLVKWTVPVNDSVDIYGNGGDTITSYL
VEYSKEPWDDFVPVIQRLQVASNAPGGVLGGTIRLSLNTTDDSNAAVKSFATSSQIFVGN
ATAYDVKIALENMENVGEVEVTGTVSGSGDSHTYDITFVDVVGNMSLLQPYAEGVTRGVN
DISFDPNLFNITELRNATVPYGAEYRQVVVDVDAGDGMDFEYFLGGPDRRSHPPLLPGVT
YYCRVAAGHTLGYGARRQTRPPYVTVPRQTPGTPGALAPGGADGIPTLEASSDQTLVVQI
GAPEFDGGDPVVYNVIQWDTSQDFTSDDGEPLGSATVAASKWLCADCVKGFDVDTHVFNY
TGKNDDPRELASGAAIYVTFPDDGLTYMFTVKSGDLYAPNKNLIYVEDSHQRVLSYAPMD
AELRVVGASYSIDGLVPGLEYYVRVASENAIKGQGDFLRTAPPSAIPVGTPSAAGTVETA
VASAHAVDVSWTASHVAGGAVSGYRVEAMTAQAIPSALGSLYGLAEVQKVSTYWTYDADE
GDGYTTAYANNATDGSFTLAFGAVDRALPGTVKMVYMKQYMTTSVDLTGHIGRGDAIVVN
GQTMTVSARRAFNSTHLYVEEVYSGDTGLAFTAYQRATTVPIAHDASANAVEGYLEQLPS
VGDVRVGRSYDEDAGGYVWSVTFLSDVGDLDPLVANPTGLLCALEDCINPSIRVVEHYAG
VEPDNYTAVTVSGAASAATMTGLATGAEYAFRVTAYSANGYGEVSAVATATPAEEPAAPT
GLARLSRHSTSQLLLQYEQSADDAGAGITSYTIQHSQSAAFPEGATVEQSFDISYEVQKV
ATDAHTLPFTEAASFSLSVGDFEGSWVLFDEHEKNRTLVDVDHNGSLVTRSLANSGADER
GELDQHFARGDFLRIGGQVFSVCLQTNALLHNVTLSYPVDDSADTYGWARYDESTLPLCK
ASDPWTAAFYDGGSREDDLRQAPLYKLDTALSGSYAPELGDARLAPRLGDSVGTAVDWRS
LGLRRGDYVRVGHPVDGETFRVSTDHTREFSEAYVPLASPDDAMSEAGLTVASLAHATYE
VQEILIYCDPTKSGATIDNKNKCNLTEGATSASGYRLVFGEELTTQTTAGGEAGCLLWDG
AAADLEAELEAMYLVDDVVVTRGDMNNAAGDSYYGVRYLVTFVGDLVRGNVPQLTVTDLG
RDGCGDAEDADASYVFGSNATAYSATLQASTVPVWKAQTTAPLAWDAEAADVKYALENLA
QVCTVDVERVVETGSNGYSWYVTFTSELESEADTAFAYQAMVGLGANEDGLDAAVLPTVS
VVPVREVVLDANVSGGPTYVRVAANNDYGRGEYRASSPLALTPSTQKPDPPAYVRAEVVS
PTELLVEWTAPLNDGGQPVTSFKVEYDPSAEFNSGAEGYPTNTTHVLATSRNARPDVQSF
TVAETTGDRYLGGFFALSFDGQDTQALPYDASAAAVEAALESLCTVDDVTVSRELRCSPA
PDAHTGCVDPQGYTWLVTFESVFYGGDQHTRFRSAYQGVSGHKLAVDGANLLSCASKEGG
GHFPDATDCFRHSANASAVATLTGSRQERQVFKCEEAVGASLSLQVRGDYTASLVKMLPG
ELFATVQPDGLPAGFPLTRGGIGKDADGLSIEEAIETVAGEVELSCYGCADYVTYNGKNV
TWVPCAGENITVNFGSARGDVPPILVSNGARARELVKGVAQEAVGQLTYSALVSTGVTSG
SSYYVRVSSYSSVGVGEAAVADLVSPLQPAVVAPREPLNAHASHVGDHEVLVGWDGPTSD
GGSDLDSFVVEWDTNPSFSSQCLEVSGFDCGDVGPVGSLEISVGRADQTIGTVAYASPDD
DDAALRRRIALPLSAADDVDEGDTINVDGNAYVVQTVNADAYFAAAEPHTVTCATDVTCV
VLTTPYVGRAVNASAPQIYAFSGASVGSIYSTEITDLKSGVEYYFRVAARTTPGWSDRPG
DPLDGYLVGPWTTAHADALCASAPDVPQVAQIGGGIVEGSCNVYDVMGCRLLEASSIRVD
WRPPALGYPEGNNGAAVSGYEVQLSGRQSAVQTLVVTVATPSFSDGSYALQSGNSTTACI
PVDADAATLELRLEELPYVDGVSVTREATSTTETVYAITYDGAYVSNYHVDPLAVVAANV
ARGPALGCAYDAGAVTIAAHWGDRYDNASTMVASHVPEVATVSTGSRTRHGKLSGVFELA
WDFTGFPDLALWANDTDSVVNATVDAGSAKVYLHHRTGANLTALLNPGDLVRIGGEVHHV
SLDASFPSRGFDKRGEYFHLVDYHLQGCDSCTVFVESTRLGHTLHGGGGKDKWSGRLLED
EAALVYFEEGLRFPPNRAYQTLESEARNSSAYRRQSVLVPFDASPMELEQALEGLPGLGS
VEVSRFGPAKDNGFVWSVTFTSLGGASRCPEAPCLTASAVTANYVELGGPGCAGDLAGPY
VETGAIYNGRSVFEKVGTPFFINWDANASSWELKANNLTLAHGPKQAFYYPRGGYEFYAA
SCVVQRRPDGDPATVPLLHNTFANGSAVAQSNDTYADARVARAGVAPSFDDTVFFESASG
GAYEVQAISLTADADDVDGVFTIAFTDTEAVTGTVFRAHAPVVVEYDATAEDVAVQLESL
ASVGRVAVSKTALPTADASSVYGAVWTVTFLTQPGDLPLLILDGSSLSGTNVALSVATSS
EGVDPTYETLATGLEPGKRYAARVRAVNSEGYGPWTDEPLRSAKGIDEPAQGQGAGVLPL
STAVGSVPDPIASVTVAAASASQFSIAYDAPESRGLPIDSYLIEWTTASSFTATSETWTI
ELRNEPWGLADLQGRWSISVGSFETHPLSPTASADAVAAALNVLRNMGAVQVEKSATRSV
ATYKVSLLQDVGDLNGFAVHTEELQSISHPLNHSISGGSVNASGAPGVKPANYGAMMVYT
EADGDAFDGAWRADGGVDVPKSRCGSVYAGLLDSWDSLQLLSLHTLDDQAHETEHYVDAG
SYRLELGGELTKCIDYAASAIEVREAIEGLEFVPSGSVRVKAFEATNQTGFPFRYSIQLL
GAYVDGAWPQLRVDPTSFGKSWRDVDVKSGCEEFSVVTTGNVPLGKSNVTASIVPMAEHG
SCASGNDEVQIVVAEADTALGGSLDLYFNGQVVEGFAVDGSPRDLEAALLALDGVDAVEV
TKHVHADQPYGIAYAVTFTGGLGRRDLLAAGASHLTGNDAAANVYPLVNISSMAILDDLE
GTFVIHVGDEMTAPLRWDATHGKVLHALHALDAVGRVAILGEPDGALEAPVYLSNGTHCG
ILAAIEGDGRGCGVQEAVVLGDLSTAVAPGDALRLSNATDAWDSGAGPSRLITAVSYVAN
FRSLPDELRLNLTQLIGRDDVADAGGITVLELSSPFHHADIMRDGRQLFAWGYYGRGDDG
GPGEDFKSKNLLGAYRAFIGETSKAKAPLPGKVSFDAATTVLQATPAAGVTNGIDYSRVV
YLAPGGVAALNASVFGNGANESEIVVAGETYKIADVNHANCGVDCLLLETPLHVSVDAGL
PATSVFPRMVTATTTADLAAPLVAGGSVWIAATRFDVLSVASTSLRLTGPFVEPAVGATA
FGWANGYAYDLVFKDFTSPLGADPGGAKKLDAIKALRARPFGGFRGTGAQLRYSLPFGIA
PRTDVLGAPSEVQTVAIRATSETAARRARNQANFTLSMAHSDQYFSDGTATLTTTTPIRW
GASAADVEAALLELNEVDQVTVKRSGDGVSAGSEHGYVYTVTFWGANHADLGIPQLEPRL
FKPDTDDTPANRTSIHVDTVREGAAPGRHASKYVAFAADAEYTFRVSAKNAVGFGPPSVL
ATGTAALAVPDAPTAVVLGEAYDAASLSVAWQPPFLDGGATISAYRVEIDSSAGFDFHGD
DYRVDEVAFVHEVQTVTTHFRAAESQRRGTFTLSWGGKTTAHLDHDASADEVADAVSRLT
GVWDVGVPPVRVTRSRAARGYAWRVQFVGVYGNVGLLTADDSYLIGDDARIEVEEVTEGY
CDVVPGGFSYEVQTVQVDALSTVSGSFKLSFEGQETASIAVDASAIEFKYALEALDTIFT
ANVVAEDYEPSKGPRLWTVTYTHQAHTLTQGAQDASLMVSDTADLSPSSTAEVVITERIK
GADAFRYAFDGLDAGKEYFARVTAYNSAGYGPVSSVATATPRTQPGLPGTVAVAVASGTS
LDVTWTPPNDDGGAPVLGYDIEWYSEETQDEVQVVTLSASDGVAEIQSVTTEADTDGLSG
YFTLELRGETTEIISVDAPAEGEGSVKTALERLSSSGEIEVSRDYSSRVVRGVSVAAGEG
KGFIEVSKGAFHQTGSSRLDQNDLVFVAGEQFRVRQIDYGAGRLELGSLDDFTTPAYFAG
ANVTDAPLTTWAFGYEWTVTFAGLVGEQPLLVAKEADLWAGTSPVLKVERVRFGQAPLKG
TFALGFEGDATPPLSHDATAADVEAALEQLSTITDVVVTRTVNNNGYNYEVAFGHPRGDV
STMYALDDMLTGPDAAARVATFTHGKDPDHFGTDRAAGDASSYQITGLDAGVGYYVKVAP
FNSEGTGLYAGPGEGADDDSSAVVGIVAPVAAPGGPEDVELYPLEPTSLRVEWSPPTDTG
GQAIVRYVVQWDTSADFGNIATSGYEALVTATADAERECYDIAISAVSSQVPRYVRVAAY
NGFAVSGFETSSPLSAAGALLPPGAPLDVVLEVTSGVGLLATWAEPSAYAGGSCGYGGDG
GSEIVEYAVEWDVTADFSSPAERVMVPATSLSFLIGGRDPLTGVESTILERGRTYWVRIT
AFSAEGASPATPTTPPSATTADSVPGEPEANPVATPVDATSLYSSWSVPSKDGGATIDAF
RVEYDPDSGFGTPQTAVAPVISEYQMLLLNADVYSEIQSIQATTLVTNEKQTVRTSVDGV
DEVQTITTSADEVTPEVQTLTTSAVDVDEIQTVLASATISDEIQVVRTSVESVAEKQRVT
YAVGDTPEVQAFGFYLLQADTNQGSLEATMDALDADLASVVPTFDISWDITDCGSAEGVN
FCQLGVDEDSAIGTISCDSDPTNDCIAASIDLYDSSNALMSTADMETALNAMSYSGTQFM
IDADGVGVNVTRTREIVGDVQAGDGSGTSCASCTGVYHVEYRVTFTGRHHRGNVPSIALT
TSSALSTYSSTYGGYTAVSGSDTIGYLSSCCDSTCSSSCPDELGPVLSGDTIQVFWYPPA
TVSGTIVGYSIQWDDAVSFADADTDAATCDTAGYGDCLAEGATISGTPPYDYVVSGLTIN
TTYYFRIAARNELYDPLDEDDVPTWSEILFATTAEQTPLAPSSATLHLAGKDKLQLEFER
PLSDGGTNLSHYLIEYDTSGTFSSPKVFNVSASEVEAAALYEDGPSMVYVTGLSAGTLYY
VRVAAVNTVGTSAWATASNPTAPAAAPDRCTTLEVSTADEQSGAPITDLDVSWLGPGNAT
NSSLSEGDNGSPIVSYLVEWYTAEATCEEQLIRATWDQDTTPSSTAGFVMQFSNGRDATT
YGVTTSKVGYDAASSLIRSSLMNLGHTAEAPYDSEYVAGPLDVQRTATNNYHGYAWTIVF
SDCADGDLNEGDLVPINVAESSVSESLEVDVSELVAGARSLGNAEVQIITIYGDMTDAQM
AVNDTTTPVKGFFRLGFDGSAYSNYIPATATAAQVAEALELLPTVGQVEVSASAYAPSAT
EAGMEYRVTFSTDVGDQPALFKDVAYLYSAVSGGSYSFSITGADNAVDDITGLKEDATVV
GEAPARYGSAVVDADQLSYTINGLESGIEYYVRVSAVNAYGAGPVLTSASNLVPQQIPDS
PSNVTVGVNDGDSDSLTVSFDAPLSDGGAEISHYRVELDPTDTFDDPIREDFYCPTANKR
TVWKVETAGTGATNPIVDGTFELTLSVSGQSYTTDPIPYDAVGSAFDETGVYETLVSSGA
VSARTFQLTNDSSVVVASGSLAGILFDNDLIQVEGQRHEGEVYRVSLLDPSGTTFNLTNP
ATDEARIFLGTSKTAAKVTRVHGGRGTSATSEVFCEEETGYCSSGGRLDFSGSVESKLEA
LDELIDAGVNVSRYGPDDTNGFSWFVTFLDDSPASSTNDFALSLSTNSLEDYNGTIGGAG
ASVTLTQWQAGETYSDCTGVSHVVPSDGSGLQNGLLYYTRVTAINSVGYSLPQATDSAMK
PMTTPGAPTSVVLSTVSATQLRVQFSSPTWDGGDEITSYLVEYATDAAFASTESVTVSYL
DGGSPFYKTISSLTKGQEYYVRVSAGNSQGYGTPQSTAPSSAAPYEESGAPSDVELGITS
DSMLTIGYAYPADDGGDDVSSYRVEWDTSSSFNSLSASPHKGTVDVDASVAMSYTIDELT
TSTTYYVRVLPINAAGYGTASATMSAAPALQVAGIPRSISVAAGTSAGEVDVEWLYPRVP
HHGVPCSAFDASPAECPTALGSSLPESTGGSAIIEYEVEWNEKDGFDGTDGGSITTTSTS
ITISGLTEERGYYVRVLARNSVGSGKFCENEGSVCTGSQLYAVATADA
NT seq 45147 nt NT seq  +upstreamnt  +downstreamnt
atggcgtcattcggctccgcggtcggttcccctttgaaattcctggtggccctcgcggcc
accgtgctcccgggcgcggcggacctccaggtcccctccgcgcccacggacgctctgttg
gaggttgtctccggcgactcgctcgcgctcgcgtgggcctcgccgatgacggacggcggc
gccgccgtccagtcgtatcaagtagaatgggacacgaaccccggcagagcagaggtccag
accgtgacgacgtcgacctacatcggcgccaacgagctgcagaccatctccacgtccgcg
gcggacatcgacgagatccagaacgtgacgaccgtcgcgagcccgatccgcgaggtccag
accgtgacggcgacggcgcccgtcggcggcacgctcgcgggcaccttcgcgctcgcgctc
gacacgcgcgtcaccggcggctcgctgcagtacacgggcgcgatccccgcggacgcggcg
acgtgctgcgggcgcacgtcgatgacggccatggtcgaggccctgtcgaacgtcggcagc
ggcaacgtctacaacgtgagccgcgaggccgtcgacgtcgacggcggcgtcggctggcga
tggcgcgtcaccttcgaccggtcgctcgcggacgtgccgcagctccagctgctggacgcg
tccgcgctgacgctcgggtcgtccatcgcgctcggcacggccgtcgagggcaacgccatc
tccggcgccttccgcttgtccttcaacggcgacacgacggcgctgatcccgtcggacgcg
accgcgggcgagctcgaggacgcgttggagctcctggacacgatcacggacgtcacggtc
atccgcggcgacgaggcggcctttggcggcttcacctggtgggtcaccttcgtccacgac
gacaacgcgggcgacgtgcccctgctcgagcccgtctggagcggcacgctcctcggcacg
tccggcgatccgtgggtcaacgtcaccgagcacgtgccgggcaacgagctctcggggtcc
ttcaacatctccttcaacggcaacgccgagagcgccaaggtgcccttcgacgcgaccgtg
tcggagctcgcgaacgcgctccagtcgctgccgcagatccccgacgggacggtggcggtc
acccgtaccggcccggacttcgagctcggctacgtctggaccgtgtccttcctcgacgac
gtcaaccgcaccttcgagggcgacgtgtcgcccctcaccgtgtcgtcgtcgacgtacctc
ggcggccagaacgcgcaggtcgacgtcgcggagctccgcaagggcaccgtcaaggagatc
cagcgcctcaacgtcacgcggacgtcgaacaaggacgacgccttctacctcaccttccgc
ggcgagacgacgggcgccatctacgcgtcgccggacaagctcgacaagtcctgcggctcc
gcggagtacgaggtccagcaggtccgcgtcgccacccaggacacgacgtccgcgggcggc
gacggcaccgtgtcgccccggacgaccttccgcctgagctacggctcggagacgacggac
tacatctacgccaacgacggcacgggcgactgctccgtcgccgccggcgagatcgagacg
gagctcgagaagttcgacgcgttctaccaggtcgacgtgtcctcctcggtgcggaattcc
cgacttcaaaggctccgatctcggtcctactcggcgacggtcgcggcgcaggagtgctgg
tggaacgtcaccttctcgtcgtcgccgggcaacgtcgccgcgctcaccgtctccgcgtcg
cgcgagggcgtcggcgccgaggacgggccggcgagctccgcgtccatcggcgacgacacg
ctctacgtccgcgaactcgtctcgggcaagacggacctcgtccagtcggagctcgagggc
ctctcgacgatcgggcgcgtcaccgtcgactcgcggcccgaccccatcaacgcgctgacc
tgcctctacacgatcaccttcgacacgaacgcgggctacctgcccctcatcggcgtcgcg
acgtccggcaccgacgagacgggcgagtggccctgggcggacacgaacacgacggtgaac
gtgacgcgcatccgcagctcgacgtccgaggcgctcagcggcgacttcgcgctggagttc
cgcggccagcgcacgggctacctgacctacgactcgtcgtcgtacgacgtcgaggccgcg
ctcgagtcgctgtcgacgatcggctccgtggcggtgaaccgcacggcggcggacgagaac
ggcggccacacctggagcatcacctttctctccgagctcggcgacgtgcccatgctcatc
gccgacgacctcgacatgtccggcaccgcggtgaccgcgacgacgtacctcgtcacgcag
ggcgtcttcccgccgttcaactccctcgacgaggccaacggcctgcccctggggtcggcg
gcggtgacggacctggcggacctgcagctcgaagtctcgggcctcgagcgcaacatcccc
tactacttccgcgtcttcgccgtcaacgcaatcggccaggggccggcgtccctcacgacg
ccgccctacgccatccccgtgccggcgaagccgtcggagccgacggacgtcgccctgagc
gtgctcgactcgacgtcgctgcgcgtcgtcctcgcggacccgctccgcgacggcggcgac
tccgtcgactcgtaccgcgtcgaatacgcgggcgaggccttcaccgacgaggtccaggcc
gtgcgcatctacgtgaattcgacgacggaggtccaggtcatcgagacgaacgtcaccgaa
aagcccgagatccagttggtccatgctttgctcgatccgagctacgcgggcgcgacgacc
gtcgagtggcagctcctcgagtgcgacgcgtcgggcggctccttcactttgaccttcgac
ggcctcacgacgcgctccatcgcctacgacgccgacgaggcgacggtgaaatcggcgctc
caggagctgacgaacgtcaacaaggtcaccgtggccttcgtcggcgtcggcctcctctcg
gacggcgtcgtcgacaccgcgtgcgtcgacggcggcgactcgcgcgtcgactacgccgac
agcgccacgggcttcacggcgggcatgaacatcaccttcaactccgtgtcggactacgtc
ggcgacgtgccggccctcgagccctacacgaacgagctcgacgggttgcggcgcgtcgtc
gtcaccgagttcgacggcgactggggcctcggcggcaccttcaagctcaccttccgcggc
gcgacgacggacgccatcgtctacgacgccagcgcgtcggccgtcgagagcgccctcatc
gcgctcgacacgatccagcagggcggcgtcgaggtctcggacgtgtccgcgtccatgtcg
acgccgtacgacagcaacgagcacctctgggaggtgaccttcgtcgggagcggcgtcggc
ggcgacgtcgaggcgctccagatccgcgcggacgacgacctgctcacgggctccggcgcg
cggctccgcgtctacgcggacggctccgagaagtcgtccgacatccggagctccgcgacg
gccgagtcccgcgcgggcagcgagctcggcggctccttcacgctgacgcttcgccagcac
accaccgagcccatcgagttcaacgcggccgcgtcgacgatgaaggcgcgcctcgaggcc
ctgccgaacgtcgggaacgtggacgtcctccgctcggctccgggcagccggcgcgaatac
gcgtggaccgtctccttcgtgtcgaatccgggctacttcccgccgaactcgcggaaccta
gcgctgttggtccccgacacgtcggacctcgagggcacgggcgccagctgcgaggtcaag
gagcggctgcagggcagcgaaccgctcaagggcgcgttccagctcatgttctgcaacagc
acgtacgcggacggctacgccgacgcgtgcgagtacacggatctgctcgagaacgacctc
gaggcgccccagttcgaggcgatcctcgaggacctggaccacgtcggcgacgtcgacgtc
tcccgcgtcacgaacagcgacggctacacctggtacatcactttcgggggctgctcgctc
acggaggacctcgaggacgtctgcaacgagggcgacgtggcgctcatgaaatggctcgag
tcgaactctaccttaacgggcggatcgtcggcgccaaatgtaaccatcgaggaggtcgtg
cgcggcaccggccctggcacgtgctcggatcgcgtcgacgaagacggcaagtgcgtcgcc
gtcgagacggatttgagcggcggcgagccctacgcctacgacatcctcggcttggagacg
ggcgagcgcgtctacgtccgcgcgcgctggcacaacgagctcggcttcgggccgtactcg
ctcagcgagcctgagtggaacgcgcccggcgccccccccgcggttcggctcttgaactcg
tccgccgtgagcgtggccgtcgcgtgggaccgccccaccgaggacggcggcgcgcccgtg
atgggctacgagctctggctcgacaactgggagggtggcgcgtcgcgcatcgtcttcgac
gggagcgatcagccggacaccatggccttcacggtgcggaccaagacgagcgtcggggtc
gagagtggcaaacagtatcgctttcttgtgcgagctgtcaattattgctcgtcgcgcgac
acggacctgctctgctacggcgaattcagcccggtctcggtcttcaccaacgacggcgag
gccgaggtcgccgtggtttcgggcggcgcgacgcccgcggcgccggtgcgaacgacggac
ccgcgggtggtcgtcaagctgcggctggggtgcgggaactggggcatgggcgtgcccgac
gacccgtccgagggcgaggcggtgcgcggcgcgcggcgcgcgcgcgacctcgacctcggc
gacgagccgcgctccaagccggcggcgctcggcgccgcggaccggcgactgatcgccaag
ctccggccggggtgcgagggctggggcatgggcgtgccctacgacccgtcgaaggcctcc
gaggacgagacgagcgcgccgcggccccgcgacggcaacggcgacgtcgtcatggacgac
gcgggcgactccggcgacgcgggcgactccggcgtcggcgcgaacggcttccgggacgtc
ttcatgggcgacgcgggcgacgcgggcgtcggcgcgaacggcttcggcgacgaggacttc
ggcggcggcttcgacgccgacgacgagcgcgagggcgacggccacggccacggcgacggc
cacggtcgggcccccgcggccccgtcgccgctgccgcacgagcggcgctacgccgcggcc
gcggcgctggagcgcagctccggttccggccgcggcggcgaggcccaggccgcgccgccg
ccggcgggcctcgggcgcgtcggcggcgcagggactcgtctctggttcgcggtgcccgcg
gacggcgagctcgacgagcccggcgcgcccgtcgtcgtcgcgctcccgggcatggggaaa
gtcaaggtcctcgtgccccccggggcccgcgaaggcgactgggtcgccttcgcgggcaac
gtggtactttcccggcgcaccggcgccgcgccgtgcggcgcgtccgccgcgcggcccgtg
gccgtcgggtcgttcgaattccattcgtccggcccggcggagctcgtgctcgagtcgctc
ggcggcgcggcggcggccgggccgccgagcgaccaggccgcgacgcgcgtcgtcggctct
cgggtcgggggcgtcgtcgcgttcgcggtgcccgcgagccacgaggtgggggcgccgctc
ctcgtcgaggcgccgggcacgccggccttccggctgcgcgtgcccgcgggcgtcgtcgag
ggcgacgcgctcctcctcgagggcaagctcgcgctcaccagcgcaggaaaagggtgcgac
gtcgcgtgggcggtgccgcgcgacggcggcttcggcggcttcggcggcttcgaggacccg
ggctccggcggcttcgcggacccgggctccggcgacgactccatcggcggcgacggcgac
gcgatctgggcgacggaccgcctcgcggagctggggctggcgctgaagctgcacgacgtc
gcgctgcggcagatgttcgacatgaacgcggacgaggccgacacgcgcgggttcgtcgag
accgtcgtgcccgcgggcgacgcccgggagaagttcctccagagcctcttcgagcgccgg
cgccagcgccgcgccgttcggcgcgccgcggccgccgagctccggcgccccgaagccgcc
tcggcgagcttgcccgcgacgcccgtgggcgtcgcgtcgctgctgcccgcgcgcgacggc
gacccgccggagctcgtcatcgacctcttccccgcgtgggacgcggacatggagtacgtg
ccgcgcggccgcgacctgggcctcgcggaccgcggcgtggacctctccggcgagcccggc
gactcgagcgggtccaaggcgtcgcccggcgcggcgctccaggtcgcgacgctggacggc
gggtccggcggcgagggcgacttcggcgaggacctgggcttcgcggaccgcggcggcggc
tacggccgcggcggctccggccgcggcgacgtcggcgcggacccgggcggcctcagcggc
ggcttcggcggcggctccggcggcgggaccccgggcctcgtcggcggcgaggcgcctcgc
gccgcggggcacccgcccgagtcctcgccgggcgctgacctgagccgcggctccggcttc
ggcggcggcgtcgacgcgatggacctctccggcgactcgagcgggtccgagacctacttg
agcggcgccggcggcttcggcggcggcggcccggggcttcacgagcgcgggggcacgtcg
gtgttcagccgcacgcggtcgcggcgaaagccggccgcggaccgccggcgccgcggcccc
gccatggcttccgccgatggtccgtcgctgggtcccgacctgggcggcctcagcgatgga
tccggcggcggccctgggcatcgcgcgggcgctcgtgctctcgatgaggccgtggatgat
gctctcgatggcaccgtggcttcgcggacgcgcctcggcgaggggcggctgcgacgctgc
gacaactacgtggagtccgacggcgacggctccagcggcgaggagttcttcgtggacaag
cgcacgcgcggcgacgacgacggctccgagccggacgacgaggcgtcggggatcctcgcg
gaccgcggcggccgcggccgcggcgtctccggcttcggctccggcgcgtccttcgcgtcc
ggcctcaagggcaagagcgtcacgagcgccgcgtccgtcgagctcgacgagggctccggc
gactcgcgggacggcgacgaggacggcggcggcgaggagggctctctggatctcagccag
gccgtgacgaggccttacttcgtctaccacgccgggttatcgcagcactcggagctcggc
gccaagcaggccaacgacgcgaaagtcttcgtgcacgtcgacaagaacccgcttcgtcgc
gaggatctcctggatgacctgttccgaagcagctacctggatagccgcgtcttgaacgaa
ttctgccgcgccgcgaacgcaccaatgtcgaacataccgaaggtcgccgtcaaggcgctg
gtgaaacacttcgacgacaacccgggctccgtgatcgtgtcgacgctgaacgtcgagacg
aagctcaagcactacgccatggagatgaaggagcgcgccgccgatcgcgagaaggcggag
aaggccgaggccgaggagaaggccgcccgcgagcaggagcgggacgtgcgtcatcgtagc
gaggtcgacatcgtcgcatgcgcgagagcaggcgtgcccttcaagagcatcgccgccgaa
cttgggaccggtgccgaagcattgacgcccggcgacgtcgccgacatcgtgcgccggctg
gcgccggagttcgatggcgtcaagggcagcctcggcgtcttcggctcggcgcgggcgctc
gagcccacggaccaggaaatgtcgctcaactccgaggacctggcgcacgcggagctcgcg
caggcgccccaggccgcgggctgcggcgtgaaggcaacgcctggctcggcggccatcacg
gaagctcaacgggtgcgtgtttcctacaacgcaacccacgtattcctccggaaattagtg
aaaaaacttcgagctcccggcggcggcctcaagccttctatcaggaagaaagccgcccgc
gacgacaaagctggcgtcggtgtgcggatgcagatcctcgcgttcctcgagatcgccatc
gggatccgacggacgttcctggtgcagtcggaccctgacgacccgctgatttcgggcccg
aacggtcgcacgacggcggctgtggacgtcccgactgaggaattgttggacgacttggaa
gttctcttcgagtcgtactggaagttgtggatggcgccgccttcgaaagaattttctaaa
atcgtcctcgacgcggacattccctccgtcgacaagctgccgggccgctccgtcgtcatg
cgccacgtcgtggaccagctctccgagggcgagttgtatcgattctatgttggcgagacg
agcgtacacgtcggctggcgcgcgcccgctccgaattccacgggcggctccgctattact
ggttacaatttgtacatgctgaactccgtctccgaccccgacccggtcaccgtcgagcgg
atcttgtcgggcagctccgagctgacaggcaccttcacgctcagcttcgacggcgccgag
acggaggctatcgacgtcgacgcaagcgccgaggacgtcaaggcgtacctcgaggacctg
tcgacgctgtcggtcgttgaagtctcgcgcaacacgacgtcgtcgtggggcgcagctgaa
tggttggttacgttcctgtcggaagccggcgacctgcccctgatgcgagcaacttcggga
aggctcagctacgactcggcgacgcccgcggcgtacgtcgagacggtgctgcccggtacg
agcgccgtgctcgtctacaacggctcgaaccagggcaggacaagagagcgaaattcccaa
cttcaaaggctcctttctcggccgttttccactcgctcggacgctcccgatgttctcgac
ttcgaagctactggcttgacgaccgactcgctctacgcgtttaaggccggcgtcgtctac
gagcaacaggtcgtgtcgctcgacctcagcggcggcgacgccttcttgcgccttgggaat
ggctacgagtggtataccatcacgttcctggaccgcgtcggagacgtcccgctcttggag
ctctcggccagcgatgcgggtggcgctcccctccgcgatttgacggccgccagaaagcgc
gagggcgaggacatcttctacacggagctcttcgagtacgacgaggacggcgagtacgtg
cactacgcagacggaggcgtggcgacgtataaccccgctcaatacgagatccagaagctc
gtcttcgacgccggctacagcggagactacaccatctcgctgaaccagagctcccgcgcg
gacggcgtcaacgacaagacggcggcgctgtcgtcgggctgcacggcctaccagatgaag
gttgcactcgaggcgctcgacaacatcgaggccgtcgacgtctcgcgcaacggcagctcg
gcgaccggcctgtcgtccacggacacggagttcgtcgaggacacgcagagcatccacgtc
aagacgtccacggacggctacttcacgctccgattgggcgatggcaccgattacacgacg
tccctcgacctcacgagcgcaacgaacgccgaggtcgaagcggcgctcgaggctttggac
ggcgtgtacgacgtctccgtcagcgacggtacggctgacgccggctccttcactggaaac
gcgtgggacgtgacctttcacagccccgtcggcgacgtgagcaatttagtggtcctcgac
tcctcgggcgacgatgacggcgacgtgacctacaacgtcgtggagctcgtcaagggcgac
tccgggcttgcggggacatacacggtagcgtacgagggctcgtactccgcggatattgcc
tacgaggcgacggccgcggatgtcgacgtcgagaaggaggtccttggttcgagcatcaag
ctcggcaacctccgcgagctcgccgcgtcgccctacgtctacgaagagcagacgatctcc
acgaccggcggcgacccgacgccgctcggcggctccttcagcctgacgttctacaacgag
acgacggggccgatcgcctacgacgcctccgcggacgccgtcaaggcggcgctcgagggg
ctgccgagcatcgaccgcgtcgacgtcgccaaggtcgagggcagctacggccaggccgac
tggctcgtgacgttccgctcggaactcggcgacctcgacctcctcgactgcgacgccagc
ctcacgacggggagcgacgcggcgtgcgccgccgacgagatcgtcgccggcgacagcgac
tcgctcacgggcaacacgccgacggtccacacggaggagaaggtcgcgggcctgccgagc
tacaccggcatgttcacgccggccgcgacgggcgactacgacgtcgtcgtgcgccagctc
acgcagggcggcctctcggcggagtactttgacaaccagtggctccagggcgatccgacg
gtcgagcgcatcgacgcggcgatcaacttcgactggggcacgggcgcgctgaccccctac
ggccgcgactacgtgtccgcgcgctggagcggcaagctcaaggcctcctacaacgagatc
tacaccatcttctgccgcgccgacgacggcatccgcctctacgtcgaccacgagctcgtc
gtcgacgcctgggagaacgcgagcgtcaccaacggcggccagcgcgtcgacctccggctc
agcgccggcggctaccacgacatcgtcgtcgagtacaaggagagagagagagagagacac
aactcccacaccaaacgcgccgctcgagacgcctcccacaccgctctcatattaggcacg
taccgcctcgccttcgccggcggcaagacgctcgagctgccgctgaacgcgacggccgcc
gcgctcgagagcgcgctcgagaaggcgcacgacgacgccgtcgacgtgtccgtgagccgt
caggacttcgccgcgggcttcggcgccgaccacgagtacacgatcacgttcctcagcgac
ctcgacgcctgggcctccgactcgctcaaggtcctgtcgcccgaggacggcaacggcgcc
gcggtcgccgaggtcaacatctcgcggcccgcggcgggcggccactaccccgtggacttt
atcctcggctacgtcggcgagtacgagctgagcgtcacgtccagcggccgccacgtcgag
ggctcgcccttcgaggtcgactgcgagcacggcgtcgcgacgtccggcgcgacgacggtc
gcgagcgacaacatcaacgaggccgtcgcgggcgacacgatcgtcctggacgtccacgcg
cgcgaccaccgccagcacgaggtgcagatcgtcgccgtggctgctcaagccgtggacacg
gtgcccgaggtgcagcgcgtccacgtcggcagctcggccttcacgctgacgttccgcgga
gccaccacgagctccttcgcgctcggcggcaccgaagccacgctcgagggcctcatcgag
gacctgccgacaatcacgggcggcgtgacggtgacggaagagacgtcctccgacggcacg
atcgacgcctcggacacgttcctggtcgaattctcgggcgtctacggcgacgtgccgctc
ctctccacgacggccaccaaggtccacgaggtcaccaagggcgacgcgccctacgtgcgc
gagatccagaccttctactgcgacgccacgtcgggcaacctcgccgtggacttccgcgac
tacgacacgacggcgtcgctcgacgtctcgacggcgacggtcgcggacctcgcgacggag
ctcgcggccgtcggcatcgccgtgtccgcctggcgccacgacgacaagaccgactccgct
ttgacgatctgcggcagcggcaacaccgtcgccgagatggtctacgtcgagttcctcgag
ctcacgggcgacctgccggccctcgagtacaacgcgtcgtcgacggccctggcgtcgagc
atcgtcgcctacagcggcggcaactacggccaggtcgacggcgtccaccccgtctggggc
accttcacgctcgagttcggcggctggacgtccgacccgatccgcgcggacgcgtccgcc
gacgagctccgcgactcgctcgaggccctgccgtccatcggcgacgtcagcgtctacaag
acgacgatcggccagtgcctcgatcagctcgaccgccagatcttcccgaacgcgtcccgc
ctgagcgtctgggaggtccacttcgacggccgctgcgcgatcagcggctgggacttttgc
ccggacacgctcggcgacgtcgccatgctcgcggccgacgcctcgggtttagcgtacgat
ctctccccctacgagcgccaggcggcgccgacggtccgggtcacggaggccatcaagggc
acgacgggcaacctcgtcacgtcgtcgggcggcgacgagatcatcgagtacagcgcgacg
caccagcagcacacggacgtgggcatcgacatgtacgagacgcagcgcctgcgctgcgcg
acccagtccggcggcaacttctccctgtccatgctcaacaacgcgacgggattgtgggag
acgacgacgaatgtgactggactgacgaacatcgcgaacctcaaggccgcgctcctcgcc
ctcccgggcgtcaagcccggcctcacggtcacgggcggcaacgccaacggcgacatctgc
tgcacggacgcgaccgcgtcgacgtgcgcgtgggtctccgtcgccttcgtcggcaacttt
ggcacgctgcccatgctcgagttcggcgaggagcagggcgtcgacctcgagatcgaggag
atcgtcaagggcatcgacagcctcgagtacgccggcgacggcctctacaggctcgcggtg
acgccgacggtgtcgggcaactacacgttcacgctccggatctcgccccagttcttcggc
ggcgccaacgccacgacggacgtgtccacggagctctccgcgggcctcatcgtcctgccg
gcgcaggcgtcgggcccccagagccaccactacgcggacctaagggcgacgacggcggtc
gagtccacgttcctcgtgcaggcgcgcgaccgcttcggcaaccgcctgggccggtccctc
gacgcgggcccgggctcccacttcgccgtcgacctcaacggcacgggcttcgagggcggc
ggccgcgagggcgaccggagcctcgtcgcgggcgccgtcgacgacaagtacgtgcccaac
acggacggcctgtacgaggcgtcctacacgcccgagctcgcgggtccccacgtcctcgag
gtcgagctcacgcagcccggcggcctcctggcgacctactacgcgcagatggactttgtc
gacccggcgctccacgccaccggctggcgcgcgtggccctaccacgagcccaagtggtgc
ccgccggaggcgttgacgccctgcgacagcacgcgcctcgacgggcccctggacctcgac
ttcggcggcctcgcgccgctgtcgcagacggagtggcccgacttccccgcggacttcttc
tccgcgcgctgggtcggccacctcctcggccccgtcgacggcgtcgtcacgctccacctc
cgcacgaccgaggccgtgtccctggtcctcgacggcgagacgctcatcgacaccatggac
gcgtcggggtcgctcgtcgacgtcgcgtcggcaaacttcacggccaccaaaaacgagctt
tacgcgctggagatctccttcgtggaggagatcgacggcgcggccatcagcttcgagtgg
accgtgggtggcgcgcaggccgtcgtcccggcgtcggcgctctactacacgcgccacgcg
aagctgtcgcccgagaccgtcgtcgtctaccccgaccgcatcgccgcggcgacgacggcg
gccgagggcgacggcaccctggcctgcgtggccctcgaggagtgctccttcgtcgtcacg
gcgacggacgccgacggcaactaccgcgtcaacacgggcgcggacgagctcgtcgtcgag
attctgggcgtcggcgactgggccggcgagggccgcacgaacgagtacgactcctacggc
gtcatcgaggtcgaccaggtcacggacgtcaacgtcgcctgggactacgtcggcacggcc
tccgtctacaacaacgtgtccaagctctacaacctctcgggcgcgttcgagacgctcctc
cgcggcgacgtgctgtccatcggcgacggcgacctccaggacgcgtcgcccgagttcatc
gccatcggcagcggcgccttctacctcaacgacaccgtcggcgccgacgagcggtccgtg
cccctcgcggacgtctggcgcggaaacgacgcgcaccgcgtccgcgtctacaagggcgcg
tacgcgggcgacaccgcgcgccatacgatatcctacacgccctacgtccgcggcacctac
gacctcgacgtgcgcgtgaagaagaccgaggaggtgcagcaggtcgtcgtctccgtgggc
gcggggctgtgcgcggggaagaagctcgcgggcaacttcacgctgtcgctcacggcgccg
gacaagttcggcgtcgtcgccacggagacgacgccgcccatcgcctacgacgcgacgccc
caggacgtcgaggacgccctcatcacgctgtcccaggtctgggcctgcaacgtctcgggc
tacaactccgcgccgaagaacgggtccaaattccgcgtcgagttcagcggcgtctacccg
ctcgtcggcgccgacttccccctcttggtgcccgacacgacggacctcacgggcaaccgc
gcggccgtcgacgtctacgaggtcgtcaagggcgtgcccgaggcgtccatcgcgggcgcg
ccgtttccgctcgtcgtctcgcccaacgacgcgtccagcgcgtggtccacggcctacggc
cgcggcctcgtccagggcgtcgccggcgagacgtccagtttcacgatcatcgccaaggac
gagtggggcaacacgcgcttcgacgcgcaggacgagagcaagttctccgtgttggccttt
gtggaaatgacgacgccgggcgcggacggctggagccgcaagaactcggacggtctggtc
gcttccacggccacggcggtcaacggctccgtcgcctacgtcggcgacggcgagtacgtc
gtgtcctacacgcccgtggcctcgggcccgacgaccgtcgccgtcgtgctgcaggacgcc
gtcgaggagcaggtcgtctcctggaacgccacggccccggacgacgccgtcaaggacggc
ggcggcgtcgtcttctccatcgcggggagcgcctccgacgaggtcgcctgggactccgag
gcgtccgacgtcgccgcggcgctctcggcgctcggctggggcgccgtcgaggtgtcgcgc
ggcatcgcgcgcggcaccgacgacctatcgaaatacgacgccgcggcgctgcgcggcctg
cagatcgattccgtcaactacgtctacagcgtgaccttttccgactacgtcggcgacgtg
ccgcccatcgaggcgcacttcccgctggacgcgaacttcatcgactacgcgtccgcgtcc
gtcgcggaggtcgtcaagggctcctggggcgtcgtcaaggcgtcggagtcgaagatcacg
gcgacgccctgggtcaacgaggccctcgtccgcgagaagcaggtcgtgcgcctcgtcggc
tcgggatcgtacgacggcaacttcacgctcgagttcaaggacgcggagacgggcatgatc
cccgtcaacgcgtccgcggcccagatgaagcaggctttggaggtgctcgagaccgtcggc
gaggtcgacgtgacgcgcttcggcgagctcggcgcgggcgcgctcggctacgagtgggtc
gtcaccttcggcaagggccgcggcacggagacggacatgacgaacctcggcgaccagccg
gcgctcatcgcgcgcaattccacgctcacgggcggcaagatcacggtctacgcgtccggc
gcgacgtcgccgggcggcaaggcgtcgcgcgacggcgtcgcgccgttccaggccgccgtg
cgccccgcggccgtcagcgccccgaactgcacggccgtcgacgccgcgggcgtcgcgggc
cgcgacggcctgaccacgggcttcttcgagcgcgagagcggcttcgtcatcgaggcgcgc
gacgcgttcggcaacctgaacccctacggcccgcgggccgagacgcagatcgtcgacgtg
tttggcaacgcctccgacgccgtgaaccacacgggctcggccttctccatcagcttcctc
ggcgagaccgtggcgatcccctacggcgcgggcatcgcggacgtcgaggtcgccatcgag
ggcctgccggacgtcggggccgtttctgtatcgacaacatcggcccacgacatcatctcg
ggctgcgtcgccaacgcgaccttcggcctctccgtcatcgacccgtcctgcgacctgagc
gcctacttcgaggtcggcgactggatccgcgtcggccgcaacatgtcgacgacgcaagtc
ttcacggtcgtccacatgcaggccgtgtccccctacgccctgacgctgagctcccagtgg
ctcggcgacgacgacggcgagctcaagatctacgagcacggcgcgggcctcaagggccac
cgcgcggcctaccgctacgtcgtcaccttcgacacgctgctcggcgacctgcccaccatg
gcggcgacgccgtcgtccatcaagttcacgacggccgtcacctactgcgagcgctaccgc
taccagaccatcaagacgtcggacaacaacgcgaacgcgacggccggcgacatgatcaac
ggcacgttcatgctcgagtaccgcggcgcgtccacgcgccagctcccgcacgacgtcacc
atgtcggcgctcgagacggcgctcgaggacgaccttcccggggtgtattccgcgtccgtc
ttggaacgccacggcccctttgcgcgcaacgagtacaagtggctcgtgcgtttggactcc
gtcgtcgacgacgcgcccgagctcctctacgcggagggctacctcctcagcggcggcgac
gccgccgtcgtcgccgacgacgacacgtgccccgccgcctccgaatcggccgcgggcgcg
cgcgtctactcgcaggcgggccgcctcggcgcgcagttcgtcgcgcggctctcgggcccc
gaggccgtgaacgcgaacgtgtcctaccggagccacggcttctacgacgcgacctacggc
acgcccgtcgtcggctcctacctcgtcgacgtctccgcgacggagagcggcggcctcgtg
ggcacctacttcaacaaccggtggctctacggcgacagcgtgctcacgcgcgtggaccac
tccatcgacttcgagttcgacgaggaggacgccatcacggagacgggcaaggaccacgtc
tccgtgcgctggacgggcttcctgcggccgtccttcgacgagcgcttcacgttccacgcg
caggtcaacgacggcgcgcggctcttcgtcgacggcgagctcctcttcgacgccttcgag
aacgaggtcgaggacgccgcgggctacgcggagttctccggcacgacgtcggcgccgctg
ctcgccggcgcgctcgtggacgtgaccatggagtggcgcgagacgacgggaaacgccgtc
gcgcggctcctctggtcctcggactcgcagccctacggcctcgtgccgtcgagccgcctc
ttccaccacgcgtcggacgccgtcatctcgtcgcccttcgtctacgcgcccgaggccgtc
aaggcgtcgacgccgctcgacgtcgagctctcgcggaacgagtgggacgagatcgtcgtc
acctgggacgcgccggcgaacgacggcggcgagcccatcgccgactataaggtcgagtgg
tggagcgccgtcgacggcgactacggcgtgcccgaggtccagacgctccgcgtgcccaag
ggcagcgaccgcggcacgttctacctctactcgccgggcggcttccgctacccctgggcc
ctgccctacgacgtcgcggcgcaggacctcgaggaggccctcgagttctgctacgacgtc
ggcgacgtgtccgtgaagcagccctacgcgacggacgacggctacgtccagtacgagatc
tccttcgacacgaacgtcggcaacttcggccccatctccgtcgacgccgcgggcttcgtc
cccgaggtctgccactccaagtaccgcctcggccgcggctgcttgaacgtgaccaacggc
accgcggcgatcctcggctcgtcgacggacgcgtccttggacgtcgagcccggcgcgcgc
tacgcgtacaccatcgacacgctctggcaaaagtcgggcacgctcgacggcttcggcgtg
cgcgtgtccgcgggcaactccgcgggccacggcatcccgtccgacgcgctctacctcaag
ccctttgcgcccgcggacgcgcccgaggaggtccaggtcgagcgcgtgcccgacgaggag
gcccagctcaaggtccagtggctcacgccgcgctggccctacgaccgccagtcgctcgtg
acggcctttgtcgtggaatactccgagacggaggactttgccgaatccgtgtctaccacg
ctttccaaggccgcctgcgcgtcgccgcgcctgctcttcgatagcgccgtcggcgaggcc
ggcgtctggatgcagcacacgctcgacgacctggagccgggcacctactactacgtccgc
gtcgccgcggtcaacgacgcgggcgtcggcgccttcggcgtcgccgcgacgacggccgcg
gccatcgccgataaattgaccgacggcgccgtcggcctcgcgacgctcgcgcacgacggc
ggcgtctccgtgtccgacgcggcgacgtccctctccgtgtcctgggcgccgccggcgtcg
gacaacggctacgacgtcacggcctacggcgtcgagtggtggcgcggctccggcgtcgac
gaggtcgaggtcgtgcagatcgacgccgtcgcgctcaacgtcacgggcacctttacttta
tcctacgagggcgccgtcacgggccacctgccctgcgacgtctccgcggcggacatggag
gacgctttggaagccctcgacacgctccgcgacgtccacgtcgagcgcgccgtcgacggc
ggcgcgaacttctcgtggacggtgacgttcctgacggagtggcccgacgcgaccgatagc
cggctggtcatcgacgacgcgggcctgtattccgtgaattcgacggtgcgcgcgcgcgtc
ggctacggcctccggcccgacctcccgggccaccgcttcacgctgtcgaacgtgaccgtc
cgctccggctcggccgtcgtccgcgcgggcggcacgtggaactccgggtcccgctcccag
gagtcggaccgcgtccacgcctacgactggatggacatcgacggcggcatctaccaggtc
gcctccgtcaacgcccaggcgaacaagatcacgctcacggaggtcttctccacggggccc
tcgggcgcgtactcggcccaagtcggcgtcaccgtgcccggctcgccgccgccgcactac
gactacgtcgaggtcgcgccgtcgctcctgtcgagctcgggccgctactcttatgtgatc
cccgacctggtgtccggcgaggcctacaccgtccgcgtgtcgtcgatcacggcgctcggc
gccgcgcagccgcgctacacgcagccgcggagcctcgcgccgccgcgccaggtgccggac
gtgcccatcaacacgcacctcctcgtctacggcggcacgtccctgcgcgtgctcttcaac
caccccgcgtccgacggcgggtcgtccgtgacgcgctaccgcatcgagtgggacacgtcc
tccgagttcgactccttcgacggctcgcccctcggctccaacacggtcttggtcgacccc
acgtccgggtcctacgacgattgtacattatcctactgcggctacaccatcggctcgctc
tcgacgggcaagaactacaccgcgcgcgtcttcgccgcgaacgcttatgggtattcgacg
acgtccgccatcccggagcccctcttcgaggccccgaagaagccgccgtcgccgccggag
accctcggcctcttcgcggtgtcgcggacgtcgctccaggtggccttcggcgactcggcc
gacgagggcggcgcggacgtgacgcacgccaagctcgagtgggacggcgtcggccccgcg
gccgcggctgccggcgggtcgagctcgctctactcgcacaacgaggtccagcgcatcacg
accgcgtcgaaataccgcgacctcgagggcacgttccgcgtcgcgttccgcggccacacg
acgggccagctcgaccacgactgcacgtccgacgacatggccgcggccctcgaggcgctc
gcgcccgtcggcgacgtcacggtgacgcgcgaggaggtcggctacggcctcgcgtggtac
gtcaccttcgaggccgccgcgggcgacgacgactggctcggcgatttaccgcaactcacc
gtctccgccgtcgacgacgacctcgcgtccaacttctcgacctacgaatcgctcgtgtcg
gcgtccctgacgggcggcgacacgctgacgacgatgacgggcacggacgcgtccatcgcc
gcggacacgctcgtcgaccgctacgacggcttctgcatccagaccgtctacacctacgcc
cagaacgccacgttactcggcaccttcgccctgaagtacgactccgaggacggcgtcgtc
gcgacgcagtacctcgaggccggcgcgaccgcggcctcggtcaaggccgcgctggaagcc
atcggcacgggcgagctcttcgtcggcgccacgcaggcggccatgggcaaggagtacacc
atcgtcttcctcgagcgcctgggccccgtgccgccgctcaccttcgacgcgtcgcgcctc
tacggcggccagaacaggtacgcgacgacgggcatcaccgtcgccgtcaccgtcgccggc
cggctcccggccatggactcgcccctccgcggcgaggccgaggtggaattggacacgctc
gacgtggactcgctcgggcgctacgtctacgagctcgaggacctggtcgcgggcgagccc
tactccgtctccgtgagcctctacaacggcgtccgctcgacctacggcctcgcgacgcac
tcgacgcccgcgtcgctcgtccccgcggcgccgccgggcccgccgcggtccgtgtccgcc
gtcgcgctctccgacggctcgctcaacgtgtcgtggacgccgcccgtcgacgccggcggc
gcggccgtgaccaagtaccgcgtcgagtacgattccacggcggcgacgcacgaggtccag
cgcgtcgagttcgagtgcgccgacggccccctcgtcggctccttcacgctgaccttcaac
ggcgtggcgacgggccccgtgcccgcgggcgcgtccgcggaccgagtccgctcggcgctc
gaggccttggccaccgtcggcgaggtctccgtgtccctcgcgtcgtcggacgacagcgcg
tcctaccagatcgcgttccggacgaacgtcggggatctcccggcgctcgaggcgtcgacg
acggcgctccgcggcagcgacggcgggcccgcgtcgtccgcggtctacgagcaggtcaag
ggcggcagcccgcccttcgacgagggcacggtcggcatctacacgctgcccctgggctcc
gtcgacgtcgtccccgtcgccgaggtccaggtcgtcgaggtcggcgcgaaagccgaggac
gtcaacggctacttctaccttagttacggcgccgcggtctccgacgcgatccccgcggac
gcgacggccgcggagatggccgcggcgctcgacgagctgaagacgctgggccccgtgacc
gtgtcgcgcgccacgaagacgcaccggacgacggagcccctccaggacccgtcctacgtc
tggtccgtgaccttcgacgcggcgctcggcgacgtgccctcgctgctcgtctacgcgggc
acgggcctcacccaggaggtcatcggcgcgcacggccacctcgagggctccgcgcccttt
ggcaacgtgtccgagctcgtcaagggcggcctccccgagtggatcgccgcgggcggcggc
gacctcgtcgccggccgcccctactacgcgcgcgtcgcggcctacacggcgacgacgacg
gcctggagcgagccgcagttagctaccttgaccgcggcgcccgagtacgccgtgccgtcg
ccccccgtcgacgtcaaggtctccgtcgcgggcccggagtcgctcgcgctctcctgggcg
ccgccggcggcgaccggcggcgcggccgtgtcccactacctcatccagtacgacctcgac
acgtccttcgacgagtcgacgggcgcgtcgcgcgtgccgctctcggagctcgcctgggac
gacaacgcgggccgctgggcctacgtgctcgacggcctcacgacgggcacgacgtactac
tgccgcgtcatgtcctacaaccacgcgggctactcggacccggagatggccgcgtcgcgc
aacgacgcgccgctctaccgcgtcgagacgacccaggccttccgcctcaaggtcgaggcg
cgcgagcgcgtcgactcgacgccgacgatcgccgcgggctcgacggccgacgccgtcgcc
caggccatcatggacctgccggacgtcgcgacgggcgccatcctcgtgcgccgctgggac
atgagctcctggacggactcgacgggcatgggcacgcactggtccggcacgaagtacgcg
tacgagatcgaattcggcaacgaccgcgacgccgtgctggcgctcacgggcgtcgacgac
gaggtccaggcgtccaacgtgacccagttcgtcacgcccgcgggcgacgcctacggcatc
gcgcccgcgtaccgcgagccgtccgcgccgacggccgtgctgctctcgtcggtgtcgcgg
tcgaacctcggcgtgtcctggtccgcgcccgacctcacgggcggctccgaggtcctcaaa
tacctcgtcgagtgggacagcgaccgcgacttctcgacgctccgcgacatggactcgtcc
ttcggttccgtcgcggcggcgaccgccggcgccgtcgtcgtcaacgcgacgaaatcggag
gcggagtcgcgccgctccgagttccagtaccagatcacgggcctcgtcatgggccggtcc
tactgggtccgcgtctccgcgtacaacgactacatgggctacggcgacgccgcgtcgtcc
gagcccgcgtccgcggcgcccgcggaccagctcctcggcgcgccgtccaagttccgcgcg
aacctgagcgacacggagatgcccgaccgcctcctcctcaccttccagcagcccgtcctc
gacggcaacggcttcgacatcgggacgggcgcggactacacgccgaacaaggccacggcc
tatcgcatcgagtggtcggcgtcgtcgtccttcccggccgccgagacgagctactacgac
tggcgcgcgctcgaggacgacgaccaggacctcgagtgcgagggcgactgcacgatcgac
ctcggcgcggaggtccagtccgtccgcgtcttctccgactccgactcgcccctgaccaac
ggctcctacaagctcatctacgcgggcccctcgtcgccgacgacgcgcctcatcgtgacg
ccgggctccgcgcgcgcggagtacgtcaacgtctccaaggacgtcgactcggcgacggtc
gcgaacgccgcggacgtcatccgcacgggcgacttcgtgcgcctcggcggcgtcgacggc
aagctctactacgtgaaccagacgacgtcgggcaactgcacgctccacgagccctactcg
acgggcctcggctcgtacgtcgatagccacaccgcggccgcggagatcgaggccttcgtc
gtgacgccgccggagacgtgcatcccctacgacgccacgcccgcggagatgctcgaccac
ctgcgcgagcagatggacgacctgcccttcgaggagacgctcgtcgtgtcgcgcgactcg
aacacgtccgtcgacagcggctaccgctaccgcgtcaccttctccggcggcgccttcagc
gcccagcccgtcgcggagctcgaggtcgtgtcgcgcctcacggcggcgacgcacggcctc
gccgacatctgcgccaacttcacgaaggcccagtccatcggctcgaacgtgtccgtgcgc
accatccaggtcgtccacagcgtcacgacggacatcgactccgacgcgctggcgcccggg
gcgccctactacctgcgcctcgcggccgtcaacgacgtcggcgtcggctcctacgcggcg
ccgtccatcgacggcaagcacgacacgctcggcgcgatcgcgccgtccgcgccgccgggc
ctgccgacgaacgtcaaagtcttcgcggagaaggagagcgcgacgagcctcctcgtcacc
tgggagaccgtcgacgacgaccacggcgccgagatcacgggctggcgcgtcgagtacgcg
aacgcgtcctactcggagacgtacgacaacgactggcacaagggcttcttcttcaaggag
gccgacgccgacgcgcgcagctttttgttggataatctcacggcgggcacgacctacgcc
gtcggcgtccgcgcggtcaacgcacgcgggcccgcgccgcccgcgtggtacgagtacacc
cgcccgtcgctgccctggtggtacgagcagacggacttgttcgacgtcaaggagggccgc
cagcgcgccgtcgcgacgtgcccgcccacgggcctcacggagtgcgtcgaggagccggac
tacttcatcctcgcgcgcgcgacgccggacgtgcccctgacgttcctcgcgcagaacggg
cccgagggcttcgcggggcccgacggcttcacggccatgtccgtcgtgacgtcctggaag
aacggcggcaaccgcggcgacgaggtcgacaagttcctcgtcgagtggtccatggacgac
cagttcgcgggcgacagttaccagtcgaagatcgtccagaacaaccggacgtccgagccc
aacgtcgagcaggtgctcaacctgacctgcgccgacgacgactgccgcggcgacatcgtg
ttcgtgcgcatctcggcgcacaactccctcggcttctccaacgtctccgagaccatggag
gccgtgccgatgaagtcgagcgacgcgccctacgcgccgtcgctcgaggcgctcgacgag
gacgcgggcgagtacacggtccaggacgtcggctcccaattactggtgaaatggaccgtg
cccgtcaacgacagcgtcgacatctacggcaacggcggcgacacgatcacgtcctacttg
gtcgaatactcgaaggagccctgggacgacttcgtccccgtgatccagcggctccaggtc
gcgtccaacgcccccggcggcgttctaggcggcacgatccgcctctcgctgaacacgacg
gacgactccaacgccgcggtgaaatccttcgcgacctcgtcgcagatcttcgtcggcaac
gcgaccgcgtacgacgtcaagatcgcgctcgagaacatggagaacgtcggcgaggtcgag
gtcacgggcacggtgtccggcagcggcgattcccacacctacgatattacgttcgtcgac
gtcgtcggcaacatgtcgctgctccagccctacgccgagggcgtcacgcgcggcgtcaac
gacatctccttcgacccgaacctctttaacatcacggagctgcgcaacgcgaccgtgccc
tacggcgccgagtaccgccaggtcgtcgtcgacgtcgacgcgggcgacggcatggacttt
gaatactttttgggcggcccggaccgccggagccacccgccgctcctgccgggcgtgacc
tactactgccgcgtcgcggcgggccacacgctcggctacggcgcgcggcgccagacgcgg
ccgccctacgtgaccgtgccccggcagacgcccggcacgcccggcgcgctcgcgcccggc
ggcgccgacggcatcccgacgctggaggcctcgagcgaccagacgctcgtcgtccagatc
ggcgcgcccgagttcgacggcggcgaccccgtcgtctacaacgtcatccagtgggacacg
tcccaggacttcacgtccgacgacggcgagccgctcggctccgcgacggtcgccgcgtcg
aagtggctctgcgccgactgcgtcaagggcttcgacgtcgacacccacgtcttcaactac
acgggcaagaacgacgacccccgcgagctcgcgagcggcgcggccatctacgtgaccttc
cccgacgacggcctcacgtacatgttcaccgtgaagtcgggcgacctgtacgcgccgaac
aagaacctcatctacgtcgaggactcgcaccagcgcgtgctctcctacgcgcccatggac
gcggagctccgcgtcgtcggcgcgtcctacagcatcgacggcttggtgcccggcctcgag
tactacgtccgcgtcgcgtccgagaacgcgatcaagggccagggcgacttcctgcgcacg
gcgccgccctcggcgatccccgtgggcacgccctccgccgccggcaccgtggagacggcc
gtcgcgtccgcgcacgccgtcgacgtgtcctggacggcgagccacgtcgccggcggcgcc
gtctcgggctaccgcgtcgaggcgatgacggcccaggccatcccctccgcgctgggctcg
ctctacggcctcgcggaggtgcagaaggtgtcgacctactggacctacgacgccgacgag
ggcgacggctacacgacggcctacgcgaacaacgcgacggacggctccttcacgctggcc
ttcggcgccgtcgaccgcgcgctgcccggcaccgtgaagatggtctacatgaagcagtac
atgaccacgtcggtagatctcacgggccacatcggccgcggcgacgccatcgtcgtcaac
ggccagaccatgaccgtgtccgcgcgccgcgcgttcaattccacgcacctctacgtcgag
gaggtctactcgggcgacacgggcctcgcgttcaccgcgtaccagcgcgcgacgacggtg
cccatcgcccacgacgcctcggccaacgccgtcgagggctacctcgagcagctcccgagc
gtcggcgacgtccgcgtgggccggtcctacgacgaggacgcgggcggctacgtctggagc
gtcacgttcctgagcgacgtcggcgacctcgaccccctcgtcgcgaacccgacgggcctc
ctctgcgccttggaggactgcatcaacccgagcatccgcgtcgtcgagcactacgcgggc
gtcgagcccgacaactacacggccgtcaccgtgtccggcgccgcgtccgcggcgacgatg
acgggcctcgcgacgggcgccgagtacgccttccgcgtgacggcctactcggcgaacggc
tacggcgaggtcagcgccgtcgcgacggcgacgcccgcggaggagccagccgcgcccacg
ggcctggcgcggctctcgcgccactccacgtcgcagctcctgctccagtacgagcagagc
gccgacgacgccggcgcgggcatcacgtcctacacgatccagcactcccagtccgcggcc
ttccccgagggcgcgacggtcgagcagtccttcgatatttcgtatgaggtccaaaaggtc
gcgacggacgcgcacacgctgcccttcaccgaggccgcgtcgttctcgctgtccgtcggc
gacttcgagggcagctgggtcctcttcgacgagcacgagaagaaccgcacgctcgtcgac
gtggaccacaacgggtccctcgtgacgcggtcgctcgcgaactcgggcgcggacgagcgc
ggcgagctcgaccagcactttgcgcgcggcgactttttgcgcatcggcggccaggtcttc
tccgtctgcctccagacgaacgcgttgctccacaacgtcacgctgtcctaccccgtcgac
gactcggccgacacctacggctgggcgcgctacgacgagtcgacgctgcctttgtgcaaa
gcgtcggacccctggaccgcggccttctacgacggcggcagccgcgaggacgacctgcgc
caggcgcccctctacaagctcgacacggccctcagcggctcctacgcgccggagctcggc
gacgcgcggctcgcgccgcgcctcggcgactccgtcggcacggccgtcgactggcggtcg
ctgggcctgcgccgcggcgactacgtccgcgtgggccaccccgtcgacggcgagacgttc
cgcgtctcgacggaccacacgcgcgagttctccgaggcctacgtgcccctcgcgtcgccc
gacgacgccatgtccgaggcgggcctcacggtcgcgtcgctcgcgcacgcgacgtacgag
gtccaggagattctgatctactgcgacccgaccaagtcgggcgcgaccatcgacaacaag
aacaagtgcaacctcacggagggcgcgacgtccgcgagcggctaccgcctcgtcttcggc
gaggagctcacgacgcagacgaccgcgggcggcgaggccggctgcctcctctgggacggc
gccgccgcggacctcgaggcggagctcgaggccatgtacctcgtcgacgacgtcgtcgtc
acgcgcggcgacatgaacaacgccgcgggcgacagctactacggcgtccgctacctcgtc
accttcgtcggcgacctcgtccgcggcaacgtgccccagctcacggtcacggacctcggc
cgcgacggctgcggcgacgccgaggacgcggacgcgtcctacgtcttcggctcgaacgcg
acggcctactcggccacgctgcaggcgagcacggtcccggtctggaaagcccagacgacg
gcgccgctcgcctgggacgccgaggccgcggacgtcaagtacgcgctcgagaacctcgcc
caggtctgcaccgtcgacgtcgagcgcgtcgtcgagacgggctcgaacggctactcgtgg
tacgtgaccttcacgtcggagctcgagagcgaggccgacacggccttcgcgtaccaggcc
atggtcggcctcggcgccaacgaggacggcctcgacgccgcggtgctgccgacggtgtcc
gtcgtgcccgtccgcgaggtcgtgctcgacgcgaacgtctccggcggcccgacgtacgtg
agggtcgccgcgaacaacgactacggccgcggcgagtaccgcgcgtcgagcccgctcgcg
ctgaccccgtcgacgcagaagcccgacccgccggcctacgtccgcgccgaggtcgtgtcg
cccaccgaactgctcgtcgagtggaccgcgccgctcaacgacggcggccagcccgtgacg
tccttcaaggtcgagtacgacccgtcggccgagttcaactccggcgccgagggctacccg
acgaacacgacgcacgttttggcgacgtcgcgcaacgcgcggcccgacgtccagtcgttc
accgtcgcggagacgacgggcgaccgctacctcggcggcttcttcgcgctgagcttcgac
ggccaggacacgcaggcgctgccctacgacgcgtccgccgcggccgtcgaggccgcgctc
gagtcgctctgcaccgtcgacgacgtcacggtgagccgcgagctccgctgctcgcccgcg
ccggacgcgcacacgggctgcgtcgacccccagggctacacgtggctcgtgaccttcgag
tccgtcttctacggcggcgaccagcacacgcggttccgctccgcctaccagggcgtctcg
ggccacaagctcgccgtcgacggcgcgaacctgctgagctgcgcgtccaaggagggcggc
ggccacttccccgacgcgacggactgcttccgccacagcgcgaacgcgtccgccgtcgcg
acgctcacgggctcgcgccaggagcgccaggtcttcaagtgcgaggaggccgtcggcgcg
tcgctgagcctccaggtccgcggcgactacacggcgtccctcgtcaagatgctgcccggc
gagctcttcgcgacggtccagcccgacgggctgccggcggggttcccgctcacgcgcggc
ggcatcggcaaggacgccgacggcctctccatcgaggaggccatcgagaccgtcgcgggc
gaggtcgagctcagctgctacggctgcgccgactacgtgacctacaacggcaagaacgtg
acctgggtgccctgcgcgggcgagaacatcaccgtcaactttgggtccgcgcgcggcgac
gtgccgccgatcctcgtgtccaacggcgcgcgcgcgcgcgagctcgtcaagggcgtcgcg
caggaggccgtgggccagctcacctactcggccctcgtgtccacgggcgtcacgtccggc
tcgtcctactacgtccgcgtgtcgtcctactcctccgtcggcgtcggcgaggccgcggtc
gcggatctagtgtcgccgctgcagcccgcggtcgtcgcgccgcgcgagcctctgaacgct
cacgcgagccacgtgggcgaccacgaggtgctcgtcggctgggacggcccgacgtccgac
ggcggctcggacctcgactccttcgtcgtcgagtgggacacgaacccgtcgttctcgtcg
cagtgcctcgaggtctcgggcttcgactgcggcgacgtcggccccgtcggctcgctggag
atctccgtcggccgcgcggaccagaccatcggcacggtggcctacgcgtcgcccgacgac
gacgatgccgcgctccggcggcgcatcgccctgccgctctccgcggcggacgacgtcgac
gagggcgacacgatcaacgtcgacgggaacgcgtacgtcgtccagacggtcaacgcggac
gcgtacttcgccgcggcggagccccacacggtgacctgcgcgacggacgtgacctgcgtc
gtgctcacgacgccctacgtcggccgcgcggtcaacgcgtccgcgccgcagatctacgcg
ttctcgggcgcgtccgtcgggtccatctactcgacggagatcacggacctcaagtccggc
gtcgagtactacttccgcgtcgccgcgcgcacgacgccgggctggagcgaccgcccgggc
gaccccctcgacggctacctcgtcggcccctggacgacggcccacgcggacgcgctgtgc
gcgtccgcgccggacgtcccccaggtcgcgcagatcggcggcggcatcgtcgaggggtcc
tgcaacgtctacgacgtcatgggctgccgcctgctggaagcctcgtcgatccgcgtcgac
tggcggccgcccgcgctcggctaccccgagggcaacaacggcgcggccgtctcgggctac
gaggtccagctctcgggccgccagtccgcggtgcagacgctcgtcgtcaccgtggcgacg
ccgtccttcagcgacgggtcctacgcgctccagagtggcaattcgacgacggcctgcatc
cccgtggacgcggacgcggcgacgctcgagctccgcctcgaggagcttccctacgtcgac
ggcgtctccgtgaccagggaggcgacctccacgacggagacggtctacgccatcacctac
gacggcgcctacgtgtccaactaccacgtcgaccccctcgccgtcgtcgcggcgaacgtc
gcgcgcgggcccgcgctcggctgcgcgtacgacgcgggcgcggtgacgatcgccgcgcac
tggggcgaccgctacgacaacgcgtcgaccatggtcgcgtcccacgtgcccgaggtcgcc
acggtgtccacgggctcgcgcacgcgccacggcaagctgtcgggcgtcttcgagctcgcg
tgggactttacgggcttcccggacctcgcgctctgggcgaacgacaccgacagcgtcgtc
aacgcgactgtcgacgccgggtcggccaaggtctacctccaccaccgcacgggcgccaac
ctgacggccctcctgaaccccggcgacctcgtgcgcatcggcggcgaggtgcaccacgtg
tcgctcgacgcgtcgttcccgtcgcgcggcttcgacaagcgcggcgagtacttccacctc
gtcgactaccacctccagggctgcgactcctgcacggtcttcgtcgagtcgacgcgcctg
ggccacacgctccacggcggcggcggcaaggacaagtggagcgggcgcctcctcgaggac
gaggcggcgctcgtctacttcgaggagggcctccggttcccgccgaaccgggcctaccag
acgctcgagtccgaggcgcgcaactcgtcggcctaccggcgccagtccgtgctcgtgccc
ttcgacgcgtcgcccatggagctcgagcaggcgctcgagggcctcccgggcctcggctcc
gtcgaggtctcgcgcttcggcccggccaaggacaacggcttcgtctggtccgtgaccttc
acgtccctcggcggcgcctcgcgctgccccgaggcgccctgcctcacggcttccgccgtc
acggccaactacgtcgagctcggcgggcccggctgcgcgggcgacctcgcggggccctac
gtcgagacgggcgcgatctacaacggccgctccgtcttcgagaaggtcggcacgcccttc
tttatcaactgggacgcgaacgcgtcgtcctgggagctcaaggccaacaacctgaccctg
gcccacgggccgaagcaggcgttctactacccgcgcggcggctacgagttctacgcggcg
tcctgcgtcgtccagcggcggcccgacggcgacccggcgaccgtgcccctgctgcacaac
accttcgccaacggctccgccgtggcccagtccaacgacacctacgcggacgcgcgcgtc
gcgcgcgcgggcgtcgcgccgtcgttcgacgacacggtcttcttcgagtccgcgtccggc
ggcgcctacgaggtccaggccatctcgttgacggcggacgccgacgacgtcgacggcgtc
ttcaccatcgccttcacggacacggaggccgtcacgggcacggtcttccgggcccacgcg
cccgtcgtcgtcgagtacgacgcgaccgccgaggacgtcgcggtccagctcgagtccctc
gcctccgtgggccgcgtcgccgtctccaagaccgcgctcccgacggccgacgcctcgtcg
gtctacggcgcggtctggaccgtgacgttcctgacgcagcccggcgacctgccgctgctc
atcctcgacgggtcctccctgtcgggcacgaacgtcgccctctccgtcgcgacgtcgtcg
gagggcgtcgacccgacctacgagaccctggcgacgggcctcgagccgggcaagcgctac
gccgcgcgcgtccgcgcggtcaactccgagggctacggcccctggaccgacgagccgctg
cggtccgccaagggcatcgacgagcccgcccagggccagggcgccggcgtgttgccgctg
tcgacggccgtcggctccgtgccggaccccatcgcgtccgtgaccgtcgcggccgcgtcc
gcgtcgcagttttccatcgcgtacgacgcgcccgagagccggggcctgcccatcgactcc
tacctcatcgagtggacgacggcgtcgtccttcacggcgacgtcggagacgtggaccatc
gagctccgcaacgagccctggggcctcgcggacctccagggccgctggtccatctccgtc
ggctccttcgagacgcacccgctctcgccgacggcgtccgcggacgccgtcgcggccgcg
ctcaacgtgctccgcaacatgggcgccgtccaggtcgagaagtcggcgacgcggtccgtc
gcgacctacaaggtgagcctcctccaggacgtcggcgacctcaacggcttcgcggtccac
accgaggagctccagtccatctcccacccgctcaaccactccatctccggcggatccgtc
aacgcctccggcgcgccgggcgtcaagcccgcgaactacggcgcgatgatggtctacacg
gaggcggacggcgacgccttcgacggcgcgtggcgcgcggacggcggcgtcgacgtgccc
aagagccgctgcggctccgtctacgcgggcctgctcgactcctgggactcgctccagctc
ctgtcgctccacaccctcgacgaccaggcccacgagacggagcactacgtcgacgccggc
tcctaccgcctcgagctcggcggcgagctcacgaagtgcatcgactacgcggcgtcggcg
atcgaggtccgcgaggccatcgagggcctcgagttcgtgccgtcggggtccgtgcgcgtc
aaggccttcgaggcgacgaaccagacgggcttccccttccgctactcgatccagctcctc
ggcgcctacgtcgacggcgcgtggccccagctccgcgtcgacccgacgtcgttcggcaag
tcgtggcgcgacgtcgacgtcaagagcggctgcgaggagttctccgtcgtcacgacgggc
aacgtgcccctgggcaagtcgaacgtgacggcgtccatcgtgcccatggccgagcacggc
tcctgcgcgtcgggcaacgacgaggtccagatcgtcgtcgccgaggccgacacggcgctc
ggcggctcgctcgacctctacttcaacggccaggtcgtcgagggcttcgccgtcgacggc
tcgccgcgggacctcgaggccgcgctcctggccctggacggcgtcgacgccgtcgaggtc
acgaagcacgtccacgcggaccagccctacggcatcgcgtacgccgtgacgttcacgggc
ggcctcggccgccgcgacctcctcgccgcgggcgcgtcgcacctcacgggcaacgacgcc
gcggcgaacgtctacccgctcgtgaacatctcgtccatggccatcctcgacgatctggag
ggcaccttcgtcatccacgtcggcgacgagatgaccgcgccgctccgctgggacgcgacg
cacggcaaggtgctccacgcgctccacgcgctcgacgccgtcggccgcgtcgccatcctc
ggcgagcccgacggcgccctcgaggccccggtctacctgagcaacggcacgcactgcggc
atcctcgcggccatcgagggcgacggccgcggctgcggcgtccaggaggccgtcgtcctg
ggcgacctcagcacggccgtcgcgcccggcgacgcgctgcgcctctcgaacgcgacggac
gcctgggactcgggcgcgggcccgagccgcctgatcacggccgtgtcctacgtcgccaac
ttccggtcgctgccggacgagctgcgcctcaacctcacgcagctcatcggccgcgacgac
gtcgccgacgccggcggcatcacggtgctcgagctcagctcgcccttccaccacgcggac
atcatgcgcgacggccgccaactgttcgcctggggctactacggccgcggcgacgacggc
ggccccggcgaggacttcaagtcgaagaacctgctcggcgcgtaccgcgcgttcatcggc
gagacgtccaaggccaaggcgccgctcccgggcaaggtgtccttcgacgcggcgacgacg
gtgctccaggcgacgcccgccgcgggcgtcacgaacggcatcgactacagccgcgtcgtc
tacctcgcccccggcggcgtcgccgcgctcaacgcgtccgtcttcggcaacggcgcgaac
gagtcggagatcgtcgtcgcgggcgagacgtacaagatcgcggacgtgaaccacgcgaac
tgcggcgtcgactgcctgctcctcgagacgccgctccacgtctccgtggacgcgggcctc
ccggcgacgtcggtcttcccgcgcatggtcacggcgacgacgacggcggacctcgccgcg
cccctcgtcgccggcggctccgtctggatcgcggcgacgcgcttcgacgtgctctcggtc
gcgtcgacgtcgctgcgcctcacgggccccttcgtcgagcccgccgtcggcgcgacggcc
tttggctgggccaacggctacgcctacgacctcgtcttcaaggacttcacgagcccgctc
ggcgcggacccgggcggcgcgaagaagctcgacgcgatcaaggcgctccgcgcgcggccc
ttcgggggcttccgcggcacgggcgcccagctccgctactcgctgccctttggcatcgcg
ccgcgcacggacgtcctcggcgccccgtcggaggtgcagaccgtggccatccgcgcgacg
tcggagacggccgcgcgccgcgcgcggaaccaggccaacttcacgctgagcatggcccac
agcgaccagtacttcagcgacggcacggcgactttgacgacgacgacgcccatccgctgg
ggcgcgtcggccgccgacgtcgaggccgcgctcctcgagctcaacgaggtcgaccaggtc
accgtgaagcgctccggcgacggcgtctccgcgggcagcgagcacggctacgtctacacc
gtcaccttctggggcgcgaaccacgcggacctgggcatcccccagctcgagccgcgcctc
ttcaagcccgacaccgacgacacgcccgcgaaccgcacgtcgatccacgtcgacacggtc
cgcgagggcgccgcgcccggccgccacgcgtcgaagtacgtcgccttcgccgcggacgcc
gagtacacgttccgcgtctccgcgaagaacgccgtcggcttcggcccgccgtccgtgctc
gccacgggcacggccgcgctcgccgtgcccgacgcgccgacggccgtcgtcctcggcgag
gcctacgacgccgcgtccctcagcgtcgcctggcagccgccgttcctcgacggcggcgcg
acgatctccgcctaccgcgtcgagatcgacagctccgcgggcttcgacttccacggcgac
gactaccgcgtcgacgaggtcgccttcgtccacgaggtccagacggtgacgacgcacttc
cgcgcggccgagtcgcagcgccgcggcacgttcacgctgtcctggggcggcaagacgacg
gcccacctcgaccacgacgcgtccgccgacgaggtcgccgacgccgtgagccgcctcacg
ggcgtctgggacgtcggcgtgccgccggtccgcgtcacgcggtcgcgcgccgcgcgcggc
tacgcgtggcgcgtccagttcgtcggcgtctacggcaacgtcggcctcctcacggccgac
gactcctacctcatcggcgacgacgcgcgcatcgaggtcgaggaggtcacggagggctac
tgcgacgtcgtgcccggcggcttctcctacgaggtgcagacggtccaggtcgacgcgctc
tcgaccgtgtcgggctccttcaagctcagcttcgagggccaggagacggcgtccatcgcc
gtcgacgcgtccgcgatcgagttcaagtacgcgctcgaggccctcgacaccatcttcacg
gccaacgtcgtcgccgaggactacgagccgtccaaggggccccgcctctggacggtcacc
tacacgcaccaggcgcacacgctcacgcagggcgcccaggacgcgtcgctcatggtctcc
gacaccgcggacctgtcgccgtcgtcgacggccgaggtcgtcatcacggagcgcatcaag
ggcgccgacgccttccgctacgccttcgacggcctcgacgcgggcaaggagtacttcgcg
cgcgtcacggcctacaactccgcgggctacggccccgtgtcgtccgtcgcgacggcgacg
ccgcgcacgcagccgggcctcccgggcaccgtcgccgtcgccgtcgcctccggcacgtcc
ctcgacgtgacctggacgccgccgaacgacgacggcggcgcgccggtcctcggctacgac
atcgagtggtactccgaggagacccaggacgaggtgcaggtcgtgacgctctccgcgtcc
gacggcgtcgcggagatccagtccgtcacgaccgaggccgacacggacggcctcagcggc
tacttcaccctcgagctccggggcgagacgacggagatcatctccgtcgacgcgcccgcc
gagggcgaggggtccgtgaagacggccctcgagcgcctcagctcgtccggcgagatcgag
gtctcgcgcgactacagctcgcgcgtcgtccgcggcgtctccgttgccgccggcgagggc
aagggcttcatcgaggtcagcaagggcgccttccaccagacgggctcgagccgcctcgac
cagaacgacctcgtcttcgtcgccggcgagcagttccgcgtgcgccagatcgactacggc
gcgggccgcctcgagctcggctcgctcgacgacttcacgacgcccgcgtacttcgcgggc
gccaacgtcaccgacgcgccgctgacgacctgggccttcggctacgagtggaccgtgacc
ttcgcgggcctcgtcggcgagcagccgctcctcgtcgccaaggaggcggacctctgggcg
ggcacgtcgcccgtcctcaaggtcgagcgcgtccgcttcggccaggcgccgctcaagggc
accttcgcgctcggcttcgagggcgacgcgacgccgccgctctcgcacgacgcgaccgcg
gcggacgtcgaggccgcgctcgagcagctctcgacgatcaccgacgtcgtcgtcacgcgc
acggtcaacaacaacggctacaactacgaggtcgccttcggccacccgcgcggcgacgtc
tcgaccatgtacgccctcgacgacatgctcacgggccccgacgccgccgcgcgcgtcgcg
acgttcacgcacggcaaggacccggaccacttcggcacggaccgcgccgcgggcgacgcg
tcgtcctaccagatcacgggcctcgacgccggcgtcggctactacgtcaaggtcgcgccc
ttcaactccgagggcacgggcctctacgcgggccccggcgagggcgccgacgacgacagc
tccgcggtcgtcggcatcgtcgcgcccgtcgccgcgcccggcggccccgaggacgtcgag
ctctacccgctcgagcccacgtcgctccgcgtcgagtggagcccgccgacggacacgggc
ggccaggccatcgtgcgctacgtcgtccagtgggacacgagcgcggatttcggcaacatc
gcgacctcgggctacgaggcgctcgtcacggcgacggcggacgcggagcgcgagtgctac
gacatcgccatctccgccgtcagcagccaggtgccgcgctacgtgcgcgtcgcggcctac
aacggcttcgccgtctcgggcttcgagacgtcgtcgccgctgagcgccgcgggcgcgctc
ctgccgcccggcgcgccgctcgacgtcgtcctcgaggtcacgtccggcgtcggcctcctc
gcgacctgggccgagccctcggcctacgccggcggctcctgcggctacggcggcgacggc
ggctcggagatcgtcgagtacgcggtcgagtgggacgtcacggccgacttctcgtcgccc
gcggagcgcgtcatggtgcccgcgacgtcgctcagcttcctcatcggcggccgcgacccg
ctcacgggcgtcgagtcgacgatcctcgagcgcggccgcacgtactgggtccgcatcacg
gccttcagcgccgagggcgcgtccccggcgacgccgacgacgcccccgagcgcgacgacg
gccgactccgtccccggcgagcccgaggcgaaccccgtcgcgacgcccgtcgacgcgacg
agcctctactcgtcgtggagcgtgccgtccaaggacggcggcgcgaccatcgacgcgttc
cgcgtcgagtacgacccggacagcgggttcggcacgccccagaccgccgtcgcgccggtc
atctccgagtaccagatgctcctgctcaacgcggacgtctacagcgagatccagtccatc
caggcgacgacgctcgtcacgaacgagaagcagaccgtgcgcacgtccgtcgacggcgtc
gacgaggtgcagaccatcacgacgtccgccgacgaggtgacgcccgaggtccagacgctg
acgacgtccgccgtcgacgtcgacgagatccagacggtcctcgcgtccgcgacgatcagc
gacgagatccaggtcgtccgcacgtccgtcgagagcgtcgccgagaagcagcgcgtcacc
tacgccgtcggcgacacgcccgaggtccaggccttcggcttctacctgctccaggcggac
acgaaccagggctcgctcgaggcgacgatggacgcgctcgacgcggacctcgcgagcgtc
gtcccgacgttcgacatctcgtgggacatcacggactgcggctccgccgagggcgtcaac
ttctgccagctcggcgtcgacgaggacagcgccatcggcaccatctcctgcgacagcgac
ccgacgaacgactgcatcgcggcctccatcgacctctacgactcgtcgaacgcgctcatg
tcgacggccgacatggagacggcgctcaacgccatgtcctactcgggcacgcagttcatg
atcgacgccgacggcgtcggcgtcaacgtgacgcgcacgcgcgagatcgtcggcgacgtc
caggccggcgacggctccggcacgtcctgcgcgtcgtgcacgggcgtctaccacgtcgag
taccgcgtcaccttcacgggccgccaccaccgcggcaacgtgccgtcgatcgcgctcacg
acgtcctccgcgctctcgacgtactcgtcgacgtacggcggctacacggccgtctcgggc
tcggacacgatcggctacctcagctcctgctgcgattccacgtgctcctcgagctgcccc
gacgagctcggccccgtcctgtccggcgacacgatccaggtcttctggtacccgccggcg
acggtgtccggcaccatcgtcggctactccatccagtgggacgacgccgtctccttcgcg
gacgcggacacggacgccgcgacgtgcgacacggccggctacggcgactgcctcgcggag
ggcgcgaccatctccggcacgccgccctacgactacgtcgtgtccggtctcacgatcaac
acgacctactacttccgcatcgccgcgcgcaacgagctctacgaccccctcgacgaggac
gacgtgccgacgtggtccgagatcctcttcgcgacgacggccgagcagacgccgctcgcg
ccgtcgtcggcgacgctgcacctcgcgggcaaggacaagctccagctcgaattcgagcgg
ccgctgtccgacggcggcacgaacctcagccactacctcatcgagtacgacacctccggc
acgttctcgagccccaaggtcttcaacgtctcggcgtccgaggtcgaggccgcggctctc
tacgaggacgggccgtcgatggtctacgtgacgggcctgagcgcgggcacgctctactac
gtgcgcgtcgccgccgtcaacaccgtcggcaccagcgcctgggcgacggcgtcgaacccg
acggcccccgcggccgcgccggaccgctgcacgaccctggaagtgtcgacggccgacgag
cagtcgggcgcgccgatcacggacttggacgtctcgtggctcggcccgggcaacgcgacg
aactcgagcctgtcggagggcgacaacggctcgcccatcgtctcctacctcgtcgagtgg
tacacggccgaggcgacgtgcgaggagcagctcatccgcgcgacctgggaccaggacacg
acgccctcgagcaccgcgggcttcgtcatgcagttcagcaacggccgcgacgcgacgacc
tacggcgtcacgacgtccaaggtcggctacgacgccgcgagctcgctgatccggtcgtcg
ctcatgaacctcggccacacggccgaggcgccctacgactccgagtacgtcgcgggcccc
ctcgacgtccagcgcacggcgacgaacaactaccacggctacgcctggaccatcgtcttc
tccgactgcgccgacggcgacctcaacgagggcgacctggtgcccatcaacgtcgccgag
agctccgtgtccgagtcgctcgaggtcgacgtctccgagctcgtcgcgggcgcgcggtcc
ctcggcaacgccgaggtccagatcatcacgatctacggcgacatgaccgacgcgcagatg
gccgtcaacgacacgacgacgcccgtcaagggcttcttccgcctcggcttcgacggcagc
gcgtactcgaactacatccccgcgacggcgacggccgcgcaggtcgccgaggccctcgag
ctcctgcccaccgtgggccaggtcgaggtctcggcgtccgcctacgcgccgtcggcgacg
gaggccggcatggagtaccgcgtcacgttctcgacggacgtcggcgaccagcccgcgctc
ttcaaggacgtcgcctacctctacagcgccgtctccggcgggtcctactcgttctccatc
acgggcgcggacaacgccgtcgacgacatcacgggcctcaaggaggacgcgacggtcgtc
ggcgaggcgcccgcgcgctacggctccgccgtcgtcgacgcggaccagctcagctacacg
atcaacggcctcgagtcgggcatcgagtactacgttcgcgtctcggcggtcaacgcctac
ggcgcgggccccgtgctcacgtcggcgtcgaacctcgtgccccagcagatccccgactcg
ccgtcgaacgtcaccgtcggcgtcaacgacggcgactcggactcgctcacggtgtccttc
gacgcgcccctcagcgacggcggcgcggagatctcgcactaccgcgtcgagctcgacccg
acggacaccttcgacgaccccatccgcgaggacttttactgcccgacggcgaacaagcgg
acggtctggaaggtcgagaccgcgggcacgggcgcgacgaaccccatcgtcgacggcacc
ttcgagctcacgctctccgtgtccggccagtcctacacgacggacccgatcccctacgac
gccgtcggcagcgccttcgacgagacgggcgtctacgagaccctcgtctcgtccggcgcc
gtgtccgcgcggacgttccagctgaccaacgactcctccgtcgtcgtcgcgtcgggctcc
ctcgcgggcatcctcttcgacaacgacctcatccaggtcgagggccagcgccacgagggc
gaggtctaccgcgtgtcgctgctcgacccgtcgggcacgacgttcaacctcacgaacccc
gccacggacgaggcgcgcatcttcctgggcacgtcgaagacggccgccaaggtcacgcgc
gtccacggcggccgcggcacgtccgcgacgtccgaggtcttctgcgaggaggagacgggc
tactgctcgagcggcggccgcctcgacttctccggctccgtggagtcgaagctcgaggcg
ctcgacgagctcatcgacgccggcgtcaacgtgagccgctacggccccgacgacacgaac
ggcttctcctggttcgtcacgttcctcgacgactcgcccgcgtcgtcgacgaacgacttc
gcgctctcgctgtcgacgaactcgctcgaggactacaacggcacgatcggcggcgccggc
gcgtcggtcacgctcacgcagtggcaggccggcgagacctactcggactgcacgggcgtg
tcccacgtcgtgccgtccgacggcagcggcctccagaacggcctgctctactacacgcgc
gtcacggcgatcaacagcgtcggctactcgctgccccaggcgacggactcggccatgaag
cccatgacgacgcccggcgcgccgacgtccgtcgtcttgtcgacggtgtcggcgacgcag
ctccgcgtccagttcagcagcccgacgtgggacggcggcgacgagatcacgtcctacctc
gtcgagtacgcgacggacgcggcctttgcgtcgacggagagcgtcaccgtgagctacctc
gacggcggctcgcccttctacaagaccatctcgtccctgaccaagggccaggagtactac
gtccgcgtctccgcgggcaacagccagggctacggcacgccccagtcgacggcgccgtcg
agcgccgcgccctacgaggagagcggcgcgcccagcgacgtcgagctcggcatcacgtcc
gactccatgctgacgatcggctacgcgtaccccgccgacgacggcggcgacgacgtgtcg
tcgtaccgcgtcgagtgggacacgtcgtcgagcttcaactcgctctccgcgtcgccccac
aagggcaccgtcgacgtcgacgcgtccgtggccatgtcctacaccatcgacgagctcacg
acgagtacgacgtactacgtgcgggtcctgcccatcaacgcggcgggctacggcaccgcg
tccgcgaccatgtccgcggcgcccgcgctccaggtcgcgggcatcccgcggtccatctcc
gtcgccgcgggcacgtccgccggcgaggtcgacgtcgagtggctctacccgcgcgtgccg
caccacggcgtgccctgctcggccttcgacgcgtcgccggccgagtgcccgacggcgctc
ggcagctcgctgcccgagtcgacgggcggctccgcgatcatcgagtacgaggtcgagtgg
aacgagaaggacggcttcgacggcacggacggcggctccatcacgacgacgtcgacgtcg
atcacgatctcgggcctcacggaggagcgcggctactacgtccgcgtgctcgcgcgcaac
tccgtcggctcgggcaagttctgcgagaacgagggctcggtctgcacgggctcccagctc
tacgccgtcgccaccgcggacgcgtag

DBGET integrated database retrieval system