KEGG   Aureococcus anophagefferens: AURANDRAFT_7475Help
Entry
AURANDRAFT_7475   CDS       T04134                                 

Definition
(RefSeq) hypothetical protein
  KO
K01193  beta-fructofuranosidase [EC:3.2.1.26]
Organism
aaf  Aureococcus anophagefferens
Pathway
aaf00052  Galactose metabolism
aaf00500  Starch and sucrose metabolism
aaf01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:aaf00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00052 Galactose metabolism
    AURANDRAFT_7475
   00500 Starch and sucrose metabolism
    AURANDRAFT_7475
Enzymes [BR:aaf01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.26  beta-fructofuranosidase
     AURANDRAFT_7475
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Glyco_hydro_32N
Motif
Other DBs
NCBI-GeneID: 20228971
NCBI-ProteinID: XP_009035396
JGI: Auran1_7475
UniProt: F0Y505
Position
Unknown
AA seq 148 aa AA seqDB search
YHVFFQHNERAATWGNIVWGHATSTDLARWTREPPILRDPPPYEAGGAWSGSLARVGGRL
AALYTCVDGARANRQCAAFPEDATLRRWVRAVENPVVAAPPPGVPGSLFRDPTEAFAWRG
RTYAGVGASLDGRGAVLLYEAASATNWT
NT seq 444 nt NT seq  +upstreamnt  +downstreamnt
taccacgtcttcttccagcacaacgagcgcgcggcgacgtggggcaacatcgtctggggc
cacgcgacgagcacggacctcgcgcggtggacgcgcgagccgcccatcctccgcgacccg
ccgccctacgaggccggcggcgcctggagcggctcgctcgcgcgcgtcggcgggcgcctc
gcggcgctctacacgtgcgtcgacggcgcgcgcgcgaaccgccagtgcgcggcgttcccg
gaggacgcgacgctgaggcggtgggtccgcgcggtggagaaccccgtcgtcgcggcgccg
ccgccgggcgtgcccgggtccctcttccgcgacccgacggaggccttcgcctggcggggg
cggacctacgcgggcgtcggcgcgtcgctggacggccgcggcgccgtgctcctctacgag
gccgcgtccgcgacgaactggacc

DBGET integrated database retrieval system